Follica WIPO Application
This is most of the content contained in Follica's WIPO Application [1]. It is reproduced here for reference.
Patent Claims
WHAT IS CLAIMED IS:
- A method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of:
- (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and
- (b) contacting said scalp, eyebrow, or scarred region with a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject.
- A method for treating an androgenetic alopecia (AGA) in a scalp, the method comprising the steps of:
- (a) disrupting an epidermis of said scalp; and
- (b) contacting said scalp with a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby treating AGA in a scalp.
- A method for increasing a size of a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of:
- (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and
- (b) contacting said scalp, eyebrow, or scarred region with a compound or factor that P-7628-PC promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby increasing a size of a hair follicle in a scalp., eyebrow, or scarred region of a subject.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from an inMbitor of an Epidermal Growth Factor (EGF) or an inhibitor of an EGF receptor.
- The method of claim 4, wherein said inhibitor of an EGF or an EGF receptor is selected from AG1478, panitumumab, nimotuzumab, HuMax EGFR, cetuximab, IMC 11F8, matuzumab, SC 100, ALT HO5 PX 1032, BMS 599626, MDX 214, and PX 1041.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is an inhibitor of a tyrosine kinase activity of an Epidermal Growth Factor (EGF) receptor.
- The method of claim 6, wherein said inhibitor of a tyrosine kinase activity of an EGF receptor is selected from gefitinib, erlotinib, canertinib, pelitϊnib, ZD 1839, CL 387785, EKI 785, and vandetanib.
- The method of claim 6, wherein said inhibitor of a tyrosine kinase activity of an EGF receptor is leflunomide.
- The method of claim 6, wherein said inhibitor of a tyrosine kinase activity of an EGF receptor is A77 1726.
- The method of aay of claims 1-3, wherein said compound or factor thai promotes a differentiation, of an uncommitted epidermal cell into a hair follicle cell is selected from aβ- catenin protein, a nucleotide encoding a β-catenin protein, an activator of a β-catenin protein, or an inhibitor of a protein that suppresses an activity of a β-catenin protein.
- The method of claim 10, wherein said activator of a β-catenin protein is selected from a Wnl7 protein, a nucleotide encoding a Wnt7 protein, or an activator of a Wnt7 protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from a fibroblast growth factor (FGF) protein, an FGF receptor, a nucleotide encoding an FGF protein or FGF receptor, an activator of an FGF protein or FGF receptor, or an inhibitor of a protein that suppresses an activity of an FGF protein or FGF receptor.
- The method of claim 12, wherein said protein that suppresses an activity of said FGF protein or FGF receptor is selected from an FGF binding protein or a nucleotide encoding an FGF binding protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from an ectodysplasin protein, an ectodysplasin receptor, a nucleotide encoding an ectodysplasin protein or ectodysplasin receptor, an activator of an ectodysplasin protein or ectodysplasin receptor, or an inhibitor of a protein that suppresses an activity of an ectodysplasin protein or ectodysplasin receptor.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is a minoxidil.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from a Noggin protein, a nucleotide encoding a Noggin protein, or an activator of a Noggin protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from a Hedgehog protein, a nucleotide encoding a Hedgehog protein, or an activator of a Hedgehog protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from a Transforming Growth Factor (TGF)-betal protein, a nucleotide encoding a TGF-betal protein, an activator of a TGF~betal protein, a TGF-beta3 protein, a nucleotide encoding a TGF-beta3 protein, and an activator of a TGF-beta3 protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from an antagonist of a Transforming Growth Factor (TGF)-betal protein and an antagonist of a TGF-beta3 protein.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell acts directly on said P-7628-PC uncommitted epidermal cell.
- The method of any of claims 1-3, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell acts on said uncommitted epidermal cell via a mesenchymal cell.
- A method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of:
- (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and
- (b) contacting said scalp, eyebrow, or scarred region with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a hair follicle cell; or (c) a hair follicle or portion thereof, wherein step (b) is performed 3-12 days after step (a), thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject.
- A method for treating an androgenetic alopecia (AGA) in a scalp, comprising the steps of:
- (a) disrupting an epidermis of said scalp; and
- (b) contacting said scalp, eyebrow, or scarred region with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a P-7628-PC hair follicle cell; or (c) a hair follicle or portion thereof, thereby treating AGA in a scalp.
- The method of any of claims 22-23, wherein said precursor is selected from a hair follicle stem cell, an epidermal cell, a dermal papilla cell, or a connective tissue sheath cell.
- The method of any of claims 1-24, further comprising the step of depilating said scalp, eyebrow, or scarred region.
- The method of any of claims 1-25, further comprising the step of administering a topical retinoid to said scalp, eyebrow, or scarred region.
- The method of any of claims 1-26, further comprising contacting said scalp, eyebrow, or scarred region with a compound or factor that suppresses an expression of a Wnt protein therein.
- The method of any of claims 1-27, further comprising contacting said scalp, eyebrow, or scarred region with an antagonist of an androgen or an antagonist of an androgen receptor.
- A method for removing a hair follicle from a skin or scalp, comprising the steps of: (a) disrupting an epidermis of said skin or scalp; and (b) contacting said skin or scalp with either: (i) an Epidermal Growth Factor (EGF) protein; (ii) an EGF receptor; (iii) a nucleotide encoding an EGF protein or EGF receptor; or (iv) a compound or factor that activates a EGF protein or EGF receptor, thereby removing hair from a skin or scalp.
- The method of claim 29, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from a Transforming Growth Factor (TGF)-betal protein, a nucleotide encoding a TGF-betal protein., an activator of a TGF-betal protein, a TGF-beta3 protein, a nucleotide encoding a TGF-beta3 protein, and an activator of a TGF-beta3 protein.
- The method of claim 29, wherein said compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell is selected from an antagonist of a Transforming Growth Factor (TGF)-betal protein and an antagonist of aTGF-beta3 protein.
- The method of any of claims 1-31, wherein the step of disrupting said scalp, eyebrow, or scarred region is performed by mechanical means.
- The method of any of claims 1-31, wherein the step of disrupting is performed by exposing said scalp, eyebrow, or scarred region to a chemical.
- The method of any of claims 1-31, wherein the step of disrupting is performed by irradiating said scalp, eyebrow, or scarred region.
- The method of any of claims 1-34, wherein the step of disrupting an epidermis comprises a disruption of a follicle of said epidermis and a disruption of an interfollicular region of said epidermis.
- The method of any of claims 1 -34, wherein the step of disrupting an epidermis comprises a disruption of a follicle of said epidermis and does not comprise a disruption of an P-7628-PC interfollicular region of said epidermis.
- The method of any of claims 1-36, wherein said subject is a human.
Patent Description
METHODS FOR GENERATING NEW HAIR FOLLICLES. TREATING BALDNESS, AND HAIR REMOVAL
FIELD OF INVENTION
0001
The present invention provides methods of treating baldness in a subject and generating new hair follicles, comprising epidermal disruption and administration of a compound that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell. The present invention also provides methods for hair removal and inducing hair pigmentation.
BACKGROUND OF THE INVENTION
0002
Follicular neogenesis is defined as the generation of new hair follicles (HF) after birth. Humans are born with a full complement of HF. which can change in size and growth characteristics as in early baldness or can ultimately degenerate and disappear as in late stages of baldness or in permanent scarring (cicatricial) alopecias. Therefore, the generation of new HF is desirable in the treatment of common baldness as well as less common hair loss conditions, such as discoid lupus erythematosis, congenital hypotrichosis, lichen planopilaris and other scarring alopecias.
SlMMARY OF THE INVENTION
0003
The present invention provides methods of treating baldness in asubject and generating new hair follicles (HF), comprising epidermal disruption and administration of a compound that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell. The present invention also provides methods for hair removal and inducing hair pigmentation.
0004
In one embodiment, the present invention provides a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting the epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject.
P-7628-PC
0005
In another embodiment, the present invention provides a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting the epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject.
0006
In another embodiment, the present invention provides a method for treating baldness in a scalp, eyebrow, or scarred region, comprising the steps of: (a) disrupting the epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound that promotes a differentiation of an uncommitted epidermal cell into a hair follicle (HF) cell, thereby treating baldness in a scalp, eyebrow, or scarred region.
0007
in another embodiment, the present invention provides a method for treating baldness in a scalp, eyebrow, or scarred region, comprising the steps of: (a) disrupting the epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell, thereby treating baldness in a scalp, eyebrow, or scarred region. In another embodiment, the baldness is an androgenetic alopecia (AGA)-induced baldness. Each possibility represents a separate embodiment of the present invention.
0008
In another embodiment, the present invention provides a method for removal of an HF from a skin or scalp of a subject, comprising the steps of: (a) disrupting an epidermis of the skin or scalp; and (b) contacting the skin or scalp with either: (i) an EGF protein; (ii) an EGF receptor; (iii) a nucleotide encoding an EGF protein or EGF receptor; or (iv) a compound or factor that activates a EGF protein or EGF receptor, thereby removing an HF from a skin or scalp of a subject.
0009
In another embodiment, the present invention provides a method for increasing a size of a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound or factor that promotes a differentiation of an
P-7628-PC uncommitted epidermal cell into a hair follicle cell, thereby increasing a size of a hair follicle in a scalp, eyebrow, or scarred region of a subject.
00010
In another embodiment, the present invention provides a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and (b) contacting said scalp, eyebrow, or scarred region with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a hair follicle cell; or (c) a hair follicle or portion thereof, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject. In another embodiment, step (b) is performed 3-12 days after step (a). Each possibility represents a separate embodiment of me present invention.
00011
In another embodiment, the present invention provides a method for treating an AGA in a scalp, comprising the steps of: (a) disrupting an epidermis of said scalp; and (b) contacting said scalp with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a hair follicle cell; or (c) a hair follicle or portion thereof, thereby treating an AGA in a scalp. In another embodiment, step (b) is performed 3-12 days after step (a). Each possibility represents a separate embodiment of the present invention.
BRIEF DESCRIPTION OF THE FIGURES
00012
Figure I: Epidermal abrasion results in de novo hair follicle (HF) formation. HF at progressive stages of development are depicted in the left, center, and right panels. The arrow in the left panel indicates a hair germ. The dark stained cells are progeny of HF stem cells in the bulge.
00013
Figure 2: BrdU labeling of HF following epidermal abrasion. HF at progressive stages of development are depicted in the left, center, and right panels.
P-7628-PC
00014
Figure 3. The wound site did not contain HF immediately after re-epithelialization. Top view (left panel) and tissue section (right panel) of the site 10 days after wound induction.
00015
Figure 4. Appearance of hair germs 12 days after wound induction. Arrow indicates hair germ.
00016
Figure 5. Epidermal Disruption-Induced HF neogenesis (EDIHN)-induced hair germs express K17. Two different hair germs are depicted in the left and right panels.
00017
Figure 6. EDIHN-induced hair germs contain dermal papilla (DP) cells, as evidenced by alkaline phosphatase (AP) staining. Arrows indicate DP cells. Left panel: hair germs. Right panel: HF at a further developmental stage.
00018
Figure 7. Histological comparison between EDIHN-induced and embryonic HF. Top left, second from left, third from left, and right panels: Progressive stages of EDIHN-induced HF development Bottom left, center, and right panels: Progressive stages of and embryonic HF development.
00019
Figure 8. Induction of several markers of embryonic HF development, Lefl (left panel), wingless/ int (Wnt) 10b (center panel), and sonic hedgehog (Shh; right panel), by EDIHN. HF structures are indicated by arrowheads.
00020
Figure 9. Proliferative activity during EDIHN, as evidenced by BrdU pulse-labeling. Progressive stages of HF development are depicted in the left, center, and right panels.
00021
Figure 10. Induction of HF markers S 100 A3 (left panel; tissue section parallel to HF axis) and S 100 A6 (right panel; cross-sectional view of follicle) by EDIHN.
00022
Figure 11. New hair growth 25 days (left panel) and 45 days (right panel) after wound induction.
00023
Figure 12. Schematic of whole-mount EDIHN assay.
P-7628-PC
00024
Figure 13 , Repopulation of stem cells in the bulge of EDIHN-induced HF5 as evidenced by retention of BrdU label following a chase period. Left panel: lower magnification: 50 X. Right panel: higher magnification: 400 X.
00025
Figure 14. A. Stem cells in EDIHN-induced HF express Kl 5. Left top panel: Top view of wound site. Bottom, far left panel: epidermis whole mount; bottom, second from left panel: same as [bottom, far left] panel but viewed under white light; right panel: tissue sections. B. Neogenesis HF proceed to next hair cycle.
00026
Figure 15. Schematic of creation of new HF by EDIHN.
00027
Figure 16. No new HF are evident 11 days after wound induction in 21 -day-old mice. Top panel: macroscopic examination; bottom left panel: AP staining of the dermis; bottom right panel: Kl 7 staining of the epidermis.
00028
Figure 17. 14 days after wound induction, new HF have begun to form as evidenced by AP staining of the dermis (left panel) and Kl 7 staining of the epidermis (right panel). Main panels: 10 X magnification. Inserts: 80 X magnification.
00029
Figure 18. 17 days after wound induction, new HF are more developed. Left panel: AP staining of the dermis; right panel: Kl 7 staining of the epidermis. Main panels: 10 X magnification. Inserts: 80 X magnification.
00030
Figure 19. Wounds closed similar in mice subjected to depilation., then wounding (left 3 mice in each panel) vs. wounding alone (right 4 mice in each panel). Left panel: immediately following wounding. Right panel: 10 days following wounding.
00031
Figure 20. Anagen induction by depilation prior to wounding enhances the efficiency of EDIHN. A. Top panel: lower left panel AP staining of the dermis; lower right panel: K17 staining of the epidermis. B. Graphical representation of enhancement of EDIHN by depilation.
P-7628-PC
00032
Figure 21. A. EDIHN in human skin grafted to immunodeficient (scid) mice, seven days after induction of an excisional wound. Arrows indicate new HF. B. Dermal abrasion of human skin grafts results in EDIHN. Human adult skin (W) was grafted onto mice, abraded, and examined seven days later, by staining for S100A6 (first, second, and fourth rows) or S100A4 (third row). Hair germs (HG) and dermal papilla (DP) are indicated. Human fetal skin (F) with normal developing hair follicles is shown for comparison. Mouse skin 17d post wounding was included as a control (top left panel).
00033
Figure 22. Transcripts up-regulated at least 2-fold in activated HF cells, as assessed by dChip analysis. (A). Mean values and standard errors of the up-regulated transcripts in non-activated ("bs- line") and activated ("expt") samples and fold-changes and differences between non-activated and activated values are depicted. (B). Raw data for up-regulated transcripts in non-activated and activated cells. "Ctrl" denotes non-activated and "High-dep" denotes activated cells. (C). Additional information about up-regulated transcripts.
00034
Figure 23. Pigmented hair follicle neogenesis observed in the skin of Dkkl -expressing mice following EDIHN A. 3.2x magnification. B. 8x magnification.
00035
Figure 24. Control mice lacked pigmented HF.
00036
Figure 25. EGF inhibits HF formation by EDIHN. A. K17 staining of wounded skin of representative mouse treated with EGF. Magnification is 4x. B. High magnification view (1 Ox) of skin depicted in (A). C. Kl 7 staining of wounded skin of representative control mouse that received no EGF after wounding. Magnification is 4x. D. Higher magnification view (10X) of skin depicted in (D).
00037
Figure 26. Administration of an EGF receptor inhibitor (AGl 478) leads to generation of more and larger HF compared with controls. A. Top: skin of 2 control mice. Outer dashed line indicates the extent of the wounded area after contraction and healing; inner dashed line indicates the area of neogenesis. Bottom: skin of 2 treated mice, in which the wounded area and area of neogenesis largely coincide, with the exception of a small area on the left side of the encircled area
P-7628-PC in each panel. B. Large hair follicles developed in the wounded area in the AG1478-injected mice. Left panel: epidermis stained for Kl 7, with three large hair follicles next to each other. Right panel: dermis stained for AP with large coalescing DP areas. Scale Bars: 200 μm.
00038
Figure 27. A. Increased hair follicle formation in K14-Wnt7a mice. Left panel: Wnt7a transgenic mice. Right panel: control (wild-type) mice. B. Quantiation of experiment with 4 week old mice. C. Quantiation of experiment with 3 week old mice
DETAILED DESCRIPTION OF THE INVENTION
00039
The present invention provides methods of treating haldness in a subject and generating new HF, comprising epidermal disruption and administration of a compound that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell. The present invention also provides methods for hair removal and inducing hair pigmentation.
00040
In one embodiment, the present invention provides a method for generating a hair follicle
(HF) in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound that promotes a differentiation of an uncommitted epidermal cell into an
HF cell, thereby generating an HF in a scalp, eyebrow, or scarred region of a subject.
00041
In another embodiment, the present invention provides a method for generating an HF in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a factor that promotes a differentiation of an uncommitted epidermal cell into an HF cell, thereby generating an HF in a scalp, eyebrow, or scarred region of a subject.
00042
In another embodiment, the present invention provides a method for generating a new HF in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a hair follicle cell, thereby generating a new HF in a scalp, eyebrow, or scarred region of a subject.
P-7628-PC
00043
In another embodiment, the present invention provides a method for increasing the number of HF in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp,, eyebrow, or scarred region with a compound or factor that promotes a differentiation of an uncommitted epidermal cell into an HF cell, thereby increasing the number of HF in a scalp, eyebrow, or scarred region of a subject.
00044
In another embodiment, the present invention provides a use of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into an HF cell, for the preparation of a pharmaceutical composition for use in a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the compound or factor.
00045
In another embodiment, the present invention provides a use of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into an HF cell, for the preparation of a pharmaceutical composition for use in a method for treating baldness in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the compound or factor.
00046
In another embodiment, the present invention provides a use of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into an HF cell, for the preparation of a pharmaceutical composition for use in a method for treating AGA in a scalp of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp with the compound or factor.
00047
In another embodiment, the present invention provides a method for increasing a size of a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of:
(a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound or factor that promotes a differentiation of an
P-7628-PC uncommitted epidermal cell into an HF cell, thereby increasing a size of a hair follicle in a scalp, eyebrow, or scarred region of a subject. In another embodiment, the factor is an inhibitor of an EGF protein or an EGFR. In another embodiment, the factor is aHedgehog protein, anucleotide encoding same or an activator of same. In another embodiment, the factor is an androgen antagonist In another embodiment, the factor is any other compound or factor that promotes a differentiation of an < uncommitted epidermal cell into an HF cell. Each possibility represents a separate embodiment of the present invention.
00048
In another embodiment, the present invention provides a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and (b) contacting said scalp, eyebrow, or scarred region with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a hair follicle cell; or (c) a hair follicle or portion thereof, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject. In another embodiment step (b) is performed 3-12 days after step (a). Each possibility represents a separate embodiment of the present invention.
00049
The precursor cell of methods and compositions of the present invention, is, in another embodiment, a HF stem cell. In another embodiment, the precursor cell is an epidermal cell In another embodiment, the precursor cell is a dermal papilla cell. In another embodiment, the precursor cell is a connective tissue sheath cell. In another embodiment, the precursor cell is any other type of cell known in the art that is capable of differentiation into a hair follicle cell. Each possibility represents a separate embodiment of the present invention.
00050
In another embodiment, the present invention provides a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of said scalp, eyebrow, or scarred region; and (b) contacting said scalp, eyebrow, or scarred region with a precursor cell that is capable of differentiation into a hair follicle cell, thereby generating a hair follicle in a scalp, eyebrow, or scarred region of a subject
P-7628-PC
00051
In another embodiment, the present invention provides a method for treating an AGA in a scalp, comprising the steps of: (a) disrupting an epidermis of said scalp; and (b) contacting said scalp with a cell selected from (a) a precursor cell that is capable of differentiation into a hair follicle cell; (b) an inductive cell that is capable of inducing differentiation of an uncommitted epidermal cell into a hair follicle cell; or (c) a hair follicle or portion thereof, thereby treating an AGA in a scalp. In another embodiment, step (b) is performed 3-12 days after step (a). Each possibility represents a separate embodiment of the present invention.
00052
In another embodiment, the present invention provides a method for treating an AGA in a scalp, comprising the steps of: (a) disrupting an epidermis of said scalp; and (b) contacting said scalp with a precursor cell that is capable of differentiation into a hair follicle cell, thereby treating an AGA in a scalp.
00053
In another embodiment, the inductive cell is a mesenchymal cell. In another embodiment, the inductive cell is any other type of inductive cell enumerated herein. In another embodiment, the inductive cell is any other type of inductive cell known in the art. Each possibility represents a separate embodiment of the present invention.
00054
"Contacting" as used herein refers, in another embodiment, to bringing the scalp, eyebrow, etc, into to contact with the compound, factor, cell, etc. In another embodiment, the term refers to embedding the compound, factor, cell, etc into the scalp, eyebrow, etc. In another embodiment, the term refers to injecting the compound, factor, cell, etc into the scalp, eyebrow, etc. In another embodiment, term refers to any other type of contacting known in the art. Each possibility represents a separate embodiment of the present invention.
00055
"Promotes a differentiation" refers, in another embodiment, to the act of increasing the percentage of cells that will differentiate as indicated. In another embodiment, the term refers to increasing the number of cells per unit area of skin that will differentiate. In anotherembodiment, the promoter of differentiation is active in the milieu of the skin. Each possibility represents a separate embodiment of the present invention.
P-762S-PC
00056
"Uncommitted epidermal cell" refers, in another embodiment, to an epidermal stem cell. In another embodiment, the epidermal cell is a bulge cell. In another embodiment, the epidermal cell is a bulge-derived cell. In another embodiment, the epidermal cell is any other type of cell known in the art that can be induced to differentiate into an HF cell.
00057
The "HF cell" that results from the diffentiation is, in another embodiment, an HF stem cell. In another embodiment, the HF cell is a dermal papilla cell. In another embodiment, the HF cell is a bulb cell. In another embodiment, the HF cell is a matrix cell. In another embodiment, the HF cell is a hair shaft cell. In another embodiment, the HF cell is an inner root sheath cell. In another embodiment, the HF cell is an outer root sheath cell. In another embodiment, the HF cell is a melanocyte stem cell. In another embodiment, the HF cell is a melanocyte. Each type of uncommitted epidermal cell and HF cell represents a separate embodiment of the present invention.
00058
In another embodiment, the present invention provides a method for treating baldness in a scalp, eyebrow, or scarred region, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a compound that promotes a differentiation of an uncommitted epidermal cell into ahair follicle (HF) cell, thereby treating baldness in a scalp, eyebrow, or scarred region, In another embodiment, the baldness is an androgenetic alopecia (AGA)-induced baldness. Each possibility represents a separate embodiment of the present invention.
00059
In another embodiment, the present invention provides a method for treating baldness in a scalp, eyebrow, or scarred region, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with a factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell, thereby treating baldness in a scalp, eyebrow, or scarred region. In another embodiment, the baldness is an androgenetic alopecia (AGA)-ϊnduced baldness. Each possibility represents a separate embodiment of the present invention.
00060
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is administed in a solution. In another embodiment, Hie
P-7628-PC compound or factor is administed in a cream. In another embodiment, the compound or factor is administed in an ointment. In another embodiment, the compound or factor is administed in a slow release formulation. In another embodiment, the compound or factor is administed in a liposome encapsulated formulation. In another embodiment, the compound or factor is directly injected. In another embodiment, the compound or factor is administed by any other method known in the art. Each possibility represents a separate embodiment of the present invention.
00061
The compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is, in another embodiment, an inhibitor of an Epidermal Growth Factor (EGF). In another embodiment, the compound or factor is an inhibitor of an EGF receptor. Each possibility represents a separate embodiment of the present invention.
00062
As provided herein (Example 11), activating one or more pathways in which EGF is involved (by injection of EGF) blocks the formation of HF. Thus, antagonizing the pathway increases HF formation, as demonstrated in Example 12.
00063
In another embodiment, the inhibitor of an EGF or an EGF receptor is panirumumab. In another embodiment, the inhibitor is AG1478. In another embodiment, the inhibitor is nimotuzumab. In another embodiment, the inhibitor is an antibody that binds EGF or EGFR. In another embodiment, the inhibitor is HuMax-EGFR® (Genmab, Copenhagen, Denmark). In another embodiment, the inhibitor is cetuximab. In another embodiment, the inhibitor is IMC 11F8. In another embodiment, the inhibitor is matuzumab. In another embodiment, the inhibitor is SC 100. In another embodiment, the inhibitor is ALT 110. In another embodiment, the inhibitor is PX 1032. In another embodiment, the inhibitor is BMS 599626. In another embodiment, the inhibitor is MDX 214. In another embodiment, the inhibitor is PX 1041. In another embodiment, the inhibitor is any other inhibitor of an EGF or an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
00064
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is an inhibitor of a tyrosine kinase activity of an EGF receptor. In another embodiment, the inhibitor is gefitinib. In another embodiment, the inhibitor is
P-7628-PC erlotinib. In another embodiment, the inhibitor is canertinib. In another embodiment, the inhibitor is leflunomide. In another embodiment, the inhibitor is A77 1726. In another embodiment, the inhibitor is pelitinib. In another embodiment, the inhibitor is ZD 1839. In another embodiment, the inhibitor is CL 3877S5. In another embodiment, the inhibitor is EKI 785. In another embodiment, the inhibitor is vandetanib. In another embodiment., the inhibitor is any other inhibitor of a tyrosine kinase activity of an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
00065
In another embodiment, the EGF or EGFR antagonist is a carboxypeptidase inhibitor from potato (PCI) protein or a homologue,, fragment or mimetic thereof. In another embodiment, the EGF or EGFR antagonist is a sprouty protein or a homologue, fragment or mimetic thereof. In another embodiment, the EGF or EGFR antagonist is an Argos protein or a homologue, fragment or mimetic thereof. In another embodiment, the EGF or EGFR antagonist is a lefty protein or a homologue, fragment or mimetic thereof. In another embodiment, the EGF or EGFR antagonist is an antibody that recognizes EGF or EGFR, or a fragment or mimetic thereof. Bi another embodiment, the EGF or EGFR antagonist is small molecule inhibitor that binds and reduces the activity of EGF or EGFR. In another embodiment^ the EGF or EGFR antagonist is CRMl 97. In another embodiment, the EGF or EGFR antagonist is IMC-C225 (ImClone Systems, New York. NY). In another embodiment, the EGF or EGFR antagonist is any other antagonist of EGF or EGFR known in the art. Each possibility represents a separate embodiment of the present invention.
00066
In another embodiment, the present invention provides a use of an inhibitor of an EGF protein or an EGF receptor for the preparation of a pharmaceutical composition for use in a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the inhibitor of an EGF protein or an EGF receptor.
00067
In another embodiment, the present invention provides a use of an inhibitor of an EGF protein or an EGF receptor for the preparation of a pharmaceutical composition for use in a method
P-7628-PC for treating baldness in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the inhibitor of an EGF protein or an EGF receptor.
00068
In another embodiment, the present invention provides a use of an inhibitor of an EGF protein or an EGF receptor for the preparation of a pharmaceutical composition for use in a method for treating AGA in a scalp of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp with the inhibitor of an EGF protein or an EGF receptor.
00069
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a β~catenin protein. In another embodiment, the compound or factor is a nucleotide that encodes a β-catenin protein. In another embodiment, the compound or factor is an activator of a β-catenin protein. In another embodiment, the compound or factor is an inhibitor of a protein that suppresses an activity of the β-catenin protein. Each possibility represents a separate embodiment of the present invention.
00070
In another embodiment, the present invention provides a use of (a) a β-catenin protein; (b) a nucleotide encoding a β-catenin protein; or (c) a compound or factor that activates a β-catenin protein,, for the preparation of a pharmaceutical composition for use in a method for generating a hair follicle in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the β-catenin protein, nucleotide, compound or factor.
00071
In another embodiment, the present invention provides a use of (a) a β-catenin protein; (b) a nucleotide encoding a β-catenin protein; or (c) a compound or factor that activates a β-catenin protein, for the preparation of a pharmaceutical composition for use in a method for treating baldness in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the β-catenin protein, nucleotide, compound or factor.
P-7628-PC
00072
In another embodiment, the present invention provides a use of (a) a β-catenin protein; (b) a nucleotide encoding a β-catenin protein; or (c) a compound or factor that activates a β-catenin protein, for the preparation of a pharmaceutical composition for use in a method for treating AGA in a scalp of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp with the β-catenin protein, nucleotide, compound or factor.
00073
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a fibroblast growth factor (FGF) protein. In another embodiment, the compound or factor is a nucleotide that encodes an FGF protein. In another embodiment, the compound or factor is an FGF receptor. In another embodiment, the compound or factor is a nucleotide that encodes an FGF receptor. In another embodiment, the compound or factor is an activator of an FGF protein. In another embodiment, the compound or factor is an activator of FGF receptor. In another embodiment, the compound or factor is an inhibitor of a protein that suppresses an activity of the FGF protein or FGF receptor. In another embodiment, the protein that is inhibited is an FGF binding protein. In another embodiment, the protein that is inhibited is FGF- bpl . Each possibility represents a separate embodiment of the present invention.
00074
Is provided herein, FGF and its receptor are upregulated, under the conditions utilized herein, upon HF stem cell differentiation (Example 9). Moreover, FGF-bpl is downregulated, under the conditions utilized herein, upon HF stem cell differentiation. Thus, FGF and its receptor promote differentiation of uncommitted epidermal cells into HF cells.
00075
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is an ectodysplasin protein (referred to, in another embodiment, as "eda"; in another embodiment, as "ectodermodysplasin protein.") In another embodiment, the ectodysplasin protein is Eda- AL In another embodiment, the compound or factor is an ectodysplasin receptor (referred to, in another embodiment, as "edar"). In another embodiment, the compound or factor is an activator of an ectodysplasin protein. In another embodiment, the compound or factor is an activator of an ectodysplasin receptor. In another embodiment, the
P-7628-PC compound or factor is an inhibitor of a protein that suppresses an activity of the ectodysplasin protein or ectodysplasin receptor. Each possibility represents a separate embodiment of the present invention.
00076
In another embodiment, the eda protein of methods and compositions of the present invention has the sequence:
MGYPEVERRELLPAAAPRERGSQGCGCGGAPARAGEGNSCLLFLGFFGLSLALHLLTLCC YLELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPKQQPLEPGEAAL HSDSQDGHQMALLNFFFPDEK-PYSEEESRRVimNKRSKSNEGADGPVKNKKICGKKAGPP GPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADKAGTR ENQPAWHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIY SQVEVYYINFTDFASYEVVVDEKPFLQCTRSffiTGKTNYNTCYTAGVCLLKΛRQKIAVKM VHADISINMSKHTTFFGAIRLGEAPAS (GenBank Accession No: NM__001399; SEQ ID No: 274). hi another embodiment, the eda protein has a sequence selected from the sequences set forth in GenBank entries NM_001005609, NMJXH005610, NM_001005611, NM_001005612, NM_001005613, NMJJ01005614, NM_001005615, AF040628, AF061194, AF061193, AF061192, AF061191, AF061190, AF061189, and AF060999. In another embodiment, the eda protein is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of an Eda protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00077
In another embodiment, the edar protein of methods and compositions of the present invention has the sequence:
MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLS CGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLP GYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGAS ANFPGTSGSSTLSPFQHAHKELS GQGHLATALπAMSTfflMAIArVLπMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKKEAP DNVVMFSEKDEFEKLTATPAKPTKSENDASSENEQLLSRSVDSDEEP APDKQGSPELCLLS
P-7628-PC
LVHLAREKSATSNKSAGIQSRRKΪOLDVYANVCGVVEGLSPTELPFDCLEKTSRMLSSTYN SEI^VVKTWRHLAESFGLKRr)EIGGMTDGMQLFDRISTAGYSIPELLTKLVQIERLDAVES LCADILEWAGVVPPASQPHAAS (GenBank Accession No: BC093872; SEQ ID No: 275). In another embodiment, the edar protein has a sequence selected from the sequences set forth in GenBank entries BC093870; BC034919; NM_021783; NM_022336; AYl 52724; AF298812; AH008077; AF130996; AF130988. In another embodiment, the edar protein is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of an Edar protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00078
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a Noggin protein. In another embodiment, the compound or factor is a nucleotide encoding a Noggin protein. In another embodiment, the compound or factor is an activator of a Noggin protein. In another embodiment, the compound or factor is an inhibitor of a protein that suppresses an activity of the Noggin protein. Each possibility represents a separate embodiment of the present invention.
00079
In another embodiment, the Noggin protein of methods and compositions of the present invention has the sequence:
MERCPSLGVTL YALVWLGLRATPAGGQHYLHIRP APSDNLPLVDLIEHPDPIFDPKEKDLNE TLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLE FSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCP VLYAWNDLGSRFWPRYVKVGSCFSKRS CSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPΠSECKCSC (GenBank Accession No: NM_005450; SEQ ED No: 276). In another embodiment, the Noggin protein has a sequence selected from the sequences set forth in GenBank entries BC034027 and U31202. In another embodiment, the Noggin protein is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of a Noggin protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
P-7628-PC
00080
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a Hedgehog protein. In another embodiment, the compound or factor is a nucleotide encoding a Hedgehog protein. In another embodiment, the compound or factor is an activator of a Hedgehog protein. In another embodiment, the compound or factor is a sonic Hedgehog protein. In another embodiment, the compound or factor is a nucleotide encoding a sonic Hedgehog protein, In another embodiment, the compound or factor is an activator of a sonic Hedgehog protein. Each possibility represents a separate embodiment of the present invention.
00081
In another embodiment, the Hedgehog protein of methods and compositions of the present invention has the sequence set forth in GenBank Accession No. NM_000193. In another embodiment, the Hedgehog protein has a sequence selected from those set forth in GenBank entries
L38518 and NP_000184. In another embodiment, the Hedgehog protein has any other Hedgehog sequence known in the art. In another embodiment, the Hedgehog protein has any other sonic
Hedgehog sequence known in the art. Each possibility represents a separate embodiment of the present invention.
00082
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a Transforming Growth Factor (TGF)-betal protein. In another embodiment, the compound or factor is a nucleotide encoding a TGF-betal protein. In another embodiment, the compound or factor is an activator of a TGF-betal protein. In another embodiment, the compound or factor is a TGF-beta3 protein, hi another embodiment, the compound or factor is a nucleotide encoding a TGF-beta3 protein. In another embodiment, the compound or factor is an activator of aTGF-beta3 protein. In another embodiment, the compound or factor is an antagonist of a TGF-betal protein, hi another embodiment, the compound or factor is an antagonist of aTGF-beta3 protein. Each possibility represents a separate embodiment of the present invention.
00083
hi another embodiment, the TGF-betal protein of methods and compositions of the present invention has the sequence set forth in GenBank Accession No. BC000125. hi another embodiment, the Hedgehog protein has a sequence selected from those set forth in GenBank entries BCOO 1180,
P-7628-PC
BC022242, and NM_000660. In another embodiment, the TGF-betal protein has any other TGF- betal sequence known in the art. Each possibility represents a separate embodiment of the present invention.
00084
In another embodiment, the TGF-beta3 protein of methods and compositions of the present invention has the sequence set forth in GenBank Accession No. J03241. In another embodiment, the Hedgehog protein has a sequence selected from those set forth in GenBank entries NM__003239, BC018503, BT007287 and X14149. In another embodiment, the TGF-beta3 protein has any other TGF-beta3 sequence known in the art. Each possibility represents a separate embodiment of the present invention.
00085
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell acts directly on the uncommitted epidermal cell, hi another embodiment, the compound or factor acts on the uncommitted epidermal cell via a mesenchymal cell. Each possibility represents a separate embodiment of the present invention.
00086
In another embodiment, the mesenchymal cell is a dermal condensate cell. In another embodiment, the mesenchymal cell is a DP cell. In another embodiment, the mesenchymal cell is another cell type or differentiation stage in the dermal condensate-DP lineage. In another embodiment, the mesenchymal cell is any other type of mesenchymal cell known in the art. Each possibility represents a separate embodiment of the present invention.
00087
The EGFR of methods and compositions of the present invention has, in another embodiment, the sequence:
MRPSGTAGAALLALLAALCP ASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRN YDLSFLKTIQEVAGYVLIALNTVERIPLENLQΠRGNMYYENSYALAVL SNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVΈSIQWRDΓVSSDFLSNMSMDFQN HLGSCQKCDPSCPNGSCWGAGEENCQKLTKΠCAQQCSGRCRGKSPSDCCHNQCAAGCTG PRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVV
TDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKI)SLSINATNIKHFKN
49
P-7628-PC
CTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEΠ RGRTKQHGQFSLAVVSLNΓΓSLGLRSLKBISDGDVΠSGNKKLCYANTINWKKLFGTSGQKT KΠSNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREF VENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWK YADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMR RRHΓVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLW iPEGEKVKiPV AIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLΓΓQLMP
FGCLLD YVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKI TDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGS KPYDGIP ASEISSILEKGERLPQPPICTIDVYMIMVKCWMID ADSRPKFRELIIEFSKMARDPQ RYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSS LSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKR PAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQ KGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA (GenBank Accession No: NM__005228; SEQ ID No: 277). In another embodiment, the EGFR has a sequence selected from the sequences set forth in GenBank entries NM_201282,NM_2012835 NM_201284, BC09476I, AF288738, AY5S8246, AY573061, X17054, AF125253, U48722, K03193, and AY698024. In another embodiment, the EGFR is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of an EGFR is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00088
The EGF of methods and compositions of the present invention has, in another embodiment, the sequence:
MLLTLΠLLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTN YEQLVVDAGVS VIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNΪEKNVSGMAINW
INEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANV AVDPVERFIFWSSEVAGSLYRADL
DGVGVKALLETSEKITAVSLDVLDKIILFWIQYNREGSNSLICSCDYDGGSVHISKHPTQHNL
FAMSLFGDRIFYSTWKMKTIWIANKIiTGKDMVRINLHSSFVPLGELKVVHPLAQPKAEDDT
P-7628-PC
WEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNECAFWNHGCTL GCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPLCFCPEGSVLER DGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANSQDI RHMHFDGTDYGTLLSQQMGMVYALDffl)PVENKIYFAHTALKWIERANMDGSQRERLIEE GVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFW TDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRR LTQNDVGHPFAVAVFEDYVWFSDWAMPSVIRVNKRTGKDRVRLQGSMLKPSSLVVVHPL AKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTCLALDGHQLLAGGEVDL KNQVTPLDDLSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGCSMYARCISEGEDATCQC LKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLG VHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHD GYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVC WVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFV VIKEHQDLKNGGQPVAGEDGQ AADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCP QVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPPHQMELTQ (GenBank Accession No: NM__001963; SEQ ID No: 278). In another embodiment, the EGF has a sequence selected from the sequences set forth in GenBank entries BC093731, AY548762, and X04571. In another embodiment, the EGF is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries, hi another embodiment, a biologically active fragment of an EGF is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00089
The beta-catenin protein of methods and compositions of the present invention has, in another embodiment, the sequence:
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDT SQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS KKEASimAIMRSPQMVSATVllTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMV ALLNKTNVKFLAITTDC
P-7628-PC
LQE.AYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKP AIVEAGG MQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAG ILSNLTCNNYKMMMVCQVGGIEALVRTVLRAGDREDITEPAIC^ AVRLHYGLPVVVKLLHPPSHWPLΠ^TVGLIIWLALCPANHAPLREQGAIPRLVQLLVRAHQ DTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNIΑVIRGLNTIPLFVQLLYSPIE NIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGV ATYAAAVLFRMSEDKPQD YKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALG MDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL (GENBAUK
Accession No: NM_001904; SEQ ID No: 279). In anoiher embodiment, the beta-catenin protein has a sequence selected from the sequences set forth in GenBank entries BC058926., X87838,
AF130085, AB062292, Z19054, and NP_001895. In another embodiment, the beta-catenin protein is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of a beta-catenin protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00090
The Wnt protein of methods and compositions of the present invention has, in another embodiment, the sequence:
MNRKARRCLGHLFLSLGMVYLWGGFSSWALGASUCNKIPGLAPRQRAICQS GSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAHAAGV AHAITAACT QGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVD AREIKQNARTLMNLH NNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRA SRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGC DLMCCGRGYNTHQYARVWQCNCKϊHWCCYVKCNTCSERTEMYTCK(GerlBankAccession No: BC008811; SEQ ID No: 280). In another embodiment, the Wnt protein has a sequence selected from the sequences set forth in GenBank entries NM_004625, D83175, U53476, and NP_004616. In another embodiment, the Wnt protein is a Wnt7 protein. In another embodiment, the Wnt protein is a Wnt7a protein. In another embodiment, the Wnt protein is Wntl protein. In another embodiment, the Wnt protein is a Wnt3 protein. In another embodiment, the Wnt protein is a Wnt3a
P-7628-PC protein. In another embodiment, the Wnt protein is a WntlO protein. In another embodiment, the Wnt protein is a Wntl Oa protein. In another embodiment, the Wnt protein is a Wntl Ob protein. In another embodiment, the Wnt protein is encoded by a nucleic acid molecule having a sequence set forth in the one of the above GenBank entries. In another embodiment, a biologically active fragment of a Wnt protein is utilized in a method of the present invention. In another embodiment, a biologically active fragment of a Wnt7 protein is utilized in a method of the present invention. In another embodiment;, a biologically active fragment of a Wnt7a protein is utilized in a method of the present invention. Each possibility represents a separate embodiment of the present invention.
00091
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a protein encoded by a ribonucleic acid (RNA) molecule having a sequence selected from the sequences set forth in SEQ ID No: 1-232. In another embodiment, the compound or factor is an RNA molecule having a sequence selected from SEQ K) No: 1-232. In another embodiment, the RNA molecule is homologous to a sequence selected from SEQ ID No: 1-232. In another embodiment, the RNA molecule is an isoform of a sequence selected from SEQ ID No: 1 -232. In another embodiment, the compound or factor increases an activity of a protein encoded by an RNA molecule having a sequence selected from SEQ ID No: 1-232. In another embodiment, the compound or factor increases an expression or level of a protein encoded by an RNA molecule having a sequence selected from SEQ ED No: 1-232. Each possibility represents a separate embodiment of the present invention.
00092
As provided herein, the transcripts depicted in Table 3 (Example 8; SEQ ID No: 1 -232), the proteins they encode, and the pathways in which the proteins participate contribute significantly to HF stem cell activation. Accordingly , under the conditions utilized herein, anagen can be induced by activation of these transcripts, proteins, and pathways. Activation of the transcripts, proteins, and pathways depicted in Table 3 is thus a method for enhancing EDIHN. In another embodiment, activation of these transcripts, proteins, and pathways represents a method for enhancing hair growth in a subject
P-7628-PC
00093
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a protein encoded by an RNA molecule having a sequence selected from the sequences set forth in SEQ ID No: 233-257. In another embodiment, the compound or factor is an RNA molecule having a sequence selected from SEQ ID No: 233-257. In another embodiment;, the RNA molecule is homologous to a sequence selected from SEQ ID No: 233-257. In another embodiment, the RNA molecule is an isoform of a sequence selected from SEQ ID No: 233-257. In another embodiment, the compound or factor increases an activity of aprotein encoded by an RNA molecule having a sequence selected from SEQ ID No: 233-257. In another embodiment, the compound or factor increases an expression or level of a protein encoded by an RNA molecule having a sequence selected from SEQ ID No: 233-257. Each possibility represents a separate embodiment of the present invention.
00094
As provided herein, the transcripts depicted in Table 4 (Example 9; SEQ ID No: 233-257). the proteins they encode, and the pathways in which the proteins participate, contribute significantly, under the conditions utilized herein, to induction of epidermal cells to differentiate into PIF stem cells. Activation of the transcripts, proteins, and pathways depicted in Table 4 is thus a method for enhancing EDIHN. In another embodiment, activation of these transcripts, proteins, and pathways represents a method for enhancing hair growth in a subject.
00095
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a compound or factor that decreases an activity of a protein encoded by an RNA molecule having a sequence selected from the sequences set forth in SEQ ID No: 258-273. In another embodiment, the compound or factor decreases an expression or level of a protein encoded by an RNA molecule having a sequence selected from SEQ ID No: 258- 273. Each possibility represents a separate embodiment of the present invention.
00096
As demonstrated by findings of the present invention, the transcripts depicted in Table 5 (Example 9; SEQ ID No: 258-273), the proteins they encode, and the pathways in which the proteins participate, contribute significantly, under the conditions utilized herein, to preventing induction of epidermal cells to differentiate into HF stem cells. Inhibition of the transcripts, proteins, and
P-7628-PC pathways depicted in Table 5 is thus a method for enhancing EDIHN. In another embodiment;, inhibition of these transcripts, proteins, and pathways represents a method for induction of hair growth in a subject.
00097
In one embodiment, the compound that modulates a protein encoded by an RNA molecule having a sequence selected from the sequences set forth in SEQ ID No: 233-273 or the nucleic acid encoding same is administered before the compound that modulates a protein encoded by an RNA molecule having a sequence selected from the sequences set forth in SEQ ID No: 1-232 or the nucleic acid encoding same. In another embodiment, the two compounds are administered simultaneously. Each possibility represents a separate embodiment of the present invention.
00098
In one embodiment, a protein encoded by an RNA sequence selected from SEQ ID No: 1 - 273, or a compound that modulates the protein, is administered before other proteins encoded by same or compounds that modulate them, in order to further enhance their effect in generating an HF or stimulating hair growth. In another embodiment, the wnt pathway is stimulated before the hedgehog pathway. In another embodiment, the two pathways are stimulated in an overlapping fashion. In another embodiment, the two pathways are stimulated simultaneously. Each possibility represents a separate embodiment of the present invention.
00099
In another embodiment, activating or decreasing expression of an RNA transcript in methods of the present invention occurs via a transcription mechanism (e.g. activation of expression of the RNA). In another embodiment, activating or decreasing expression of the RNA transcript occurs via a translationaϊ mechanism. In another embodiment, activating or decreasing expression of the RNA transcript occurs via a post-translational mechanism. Each possibility represents a separate embodiment of the present invention.
000100
In another embodiment, the nucleic acid molecule utilized in methods of the present invention is a deoxyribonucleic acid (DNA) molecule that encodes an RNA molecule having a sequence selected from the sequences set forth in the present invention.
000101
In one embodiment, an RNA molecule of the present invention encodes a protein that plays
P-7628-PC a role in HF regeneration. In another embodiment, the RNA molecule is itself catalytically active, e.g., a ribozyme, etc. Each possibility represents a separate embodiment of the present invention.
000102
In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is a compound or factor that promotes placodal cell fate. As provided herein, factors that promote placodal cell fate enhance EDIHN, as exemplified in the
Examples herein. In another embodiment, the compound or factor acts at the placode stage of HF development.
000103
In another embodiment, the compound or factor inhibits a biological factor that inhibits a differentiation of an uncommitted epithelial cell into an HF cell
000104
In another embodiment of methods and compositions of the present invention, a composition comprising one of the above compounds or factors is administered. Each of the above types of compounds, factors, and compositions represents a separate embodiment of the present invention.
000105
In one embodiment, the present invention provides a method for generating an HF in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with minoxidil, thereby generating an HF in a scalp, eyebrow, or scarred region of a subject.
000106
In one embodiment, the present invention provides a method for treating baldness in a scalp, eyebrow, or scarred region of a subject, comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with minoxidil, thereby treating baldness in a scalp, eyebrow, or scarred region of a subject.
000107
In another embodiment, the present invention provides a use of minoxidil for the preparation of a pharmaceutical composition for use in a method for an HF in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the minoxidil.
P-7628-PC
000108
In another embodiment, the present invention provides a use of minoxidil for the preparation of a pharmaceutical composition for use in a method for treating baldness in a scalp, eyebrow, or scarred region of a subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the minoxidil.
000109
In another embodiment, the present invention provides a method for removal of an HF from a skin or scalp of a subject, comprising the steps of: (a) disrupting an epidermis of the skin or scalp; and (b) contacting the skin or scalp with either: (i) an EGF protein; (ii) an EGF receptor; (iii) a nucleotide encoding an EGF protein or EGF receptor; or (iv) a compound or factor that activates a EGF protein or EGF receptor, thereby removing an HF from a skin or scalp of a subject.
000110
In another embodiment, the present invention provides a method for hair removal from a skin or scalp of a subject, comprising the steps of: (a) disrupting an epidermis of the skin or scalp; and (b) contacting the skin or scalp with either: (i) an EGF protein; (ii) an EGF receptor; (iii) a nucleotide encoding an EGF protein or EGF receptor; or (iv) a compound or factor that activates a EGF protein or EGF receptor, thereby removing hair from a skin or scalp of a subject. In another embodiment, the epidermal disruption is light dermabrasion. In another embodiment, the epidermal disruption is a non-scarring method. In another embodiment, administration of the EGF protein, EGF receptor, nucleotide, compound, or factor suppresses HF formation. In another embodiment, the EGF protein, EGF receptor, nucleotide, compound, or factor is administered within several days of healing. In another embodiment, the EGF protein, EGF receptor, nucleotide, compound, or factor is administered within about 1 day of healing. In another embodiment, the EGF protein, EGF receptor, nucleotide, compound, or factor is administered according to any of the timing embodiments enumerated herein for Dkkl protein. Each possibility represents a separate embodiment of the present invention.
000111
In another embodiment, the present invention provides a use of either: (i) an EGF protein; (ii) an EGF receptor; (iii) a nucleotide encoding an EGF protein or EGF receptor; or (iv) a compound or factor that activates a EGF protein or EGF receptor, for the preparation of a pharmaceutical composition for use in a method for removal of an HF from a skin or scalp of a
P-7628-PC subject, the method comprising the steps of: (a) disrupting an epidermis of the scalp, eyebrow, or scarred region; and (b) contacting the scalp, eyebrow, or scarred region with the EGF protein, EGF receptor, nucleotide, compound, or factor.
000112
In another embodiment, a composition or method of the present invention is utilized on human skin. In another embodiment, the composition or method is utilized on an area of unwanted hair growth. IQ another embodiment, the area is the face. In another embodiment, the area is the bikini area. In another embodiment, the area is the legs. In another embodiment, the area is the arms.
In another embodiment, the area is the chest.
000113
An "inhibitor" utilized in methods and compositions of the present invention is, in another embodiment, an antibody that binds the protein or biological factor that is the target of the inhibitor.
In another embodiment, the inhibitor is a pharmacologic inhibitor. In another embodiment, the inhibitor is any other type of inhibitor known in the art. Each possibility represents a separate embodiment of the present invention.
000114
The step of disrupting the epidermis in methods of the present invention is performed, in another embodiment, by abrading the scalp, eyebrow, or scarred region.3n another embodiment, the term "abrading" refers to an act of creating an abrasion. In another embodiment, "abrading" refers to rubbing. In another embodiment, "abrading" refers to wearing away by friction. As provided herein (Example 1), epidermal abrasion causes, under the conditions utilized herein, de novo HF neo- genesis. In another embodiment, the epidermal layer is disrupted.
000115
In one embodiment, "abrasion" has the same meaning as "abrading." In another embodiment, "abrasion" refers to an area of the scalp or skin from which the epidermis is removed. In another embodiment, "abrasion" refers to an area of the scalp or skin from which the epidermis and dermis are removed. Each definition of "abrading" and "abrasion" represents a separate embodiment of the present invention.
000116
As provided herein, under the conditions utilized, epidermal disruption by a method of the present invention converts the skin back, in another embodiment, to an embryonic-like state, in which the follicle regenerates. In another embodiment, a subsequent window of opportunity is
P-7628-PC created, during which the number and size of new HF in the skin can be manipulated. In another embodiment, the administration of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell during this window causes regeneration of larger and more numerous HF. The morphology of HF in abraded sldn is similar to that of embryonic HF (Example 1-2 and subsequent Examples), and the markers expressed are similar as well.
000117
In another embodiment, the present invention provides a method of stimulating hair growth in a scalp, eyebrow, or scarred region of a subject, comprising performing a method of present invention, thereby stimulating hair growth in a scalp, eyebrow, or scarred region of a subject. As demonstrated in Example 3, EDIHN-induced HF are capable of generating hairs. Thus, methods of the present invention can be used to stimulate hair growth.
000118
"EDIHN," in another embodiment, refers to HF neogenesis induced by disruption of the epithelial layer. In another embodiment, the term refers to HF neogenesis induced by abrasion. In another embodiment, the term refers to HF neogenesis induced by wounding. In another embodiment, the term refers to HF neogenesis induced by disruption of the epithelial layer, followed by administration of a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell. Each possibility represents a separate embodiment of the present invention.
000119
In another embodiment, the present invention provides a method of testing an ability of a compound to modulate HF generation in vivo, comprising (a) disrupting an epithelial layer of a first scalp, eyebrow, or scarred region, whereby the first scalp, eyebrow, or scarred region has been contacted with the compound; (b) measuring a first HF generation in the first scalp, eyebrow, or scarred region; (c) disrupting an epithelial layer of a second scalp, eyebrow, or scarred region, wherein the second scalp, eyebrow, or scarred region is a scalp, eyebrow, or scarred region of the first subject or a second subject, whereby the second scalp, eyebrow, or scarred region has not been contacted with the compound; (d) measuring a second HF generation in the second scalp, eyebrow, or scarred region; and (e) comparing the first HF generation to the second HF generation, whereby a difference between the first HF generation and the second HF generation indicates that the
P-7628-PC compound modulates an HF generation in vivo (Examples).
000120
In another embodiment, the present invention provides a method of testing an ability of a compound to stimulate hair growth in vivo, comprising disrupting an epithelial layer of a first scalp, eyebrow, or scarred region, whereby the first scalp, eyebrow, or scarred region has been contacted with the compound; measuring a first HF generation in the first scalp, eyebrow, or scarred region; disrupting an epithelial layer of a second scalp, eyebrow, or scarred region, whereby the second scalp, eyebrow, or scarred region has not been contacted with the compound; measuring a second
HF generation in the second scalp, eyebrow, or scarred region; and comparing the first HF generation to the second HF generation, whereby a difference between the first HF generation and the second HF generation indicates that the compound stimulates a hair growth in vivo.
000121
In one embodiment, the methods of the present invention of testing a compound are repeated using a plurality of subjects, until a statistically significant sample has been tested.
000122
In another embodiment of methods for testing compounds of the present invention, the first scalp, eyebrow, or scarred region is a scalp, eyebrow, or scarred region of a first subject. In another embodiment, the subject is a subject in need of generation of a new HF. The second scalp, eyebrow, or scarred region, in another embodiment, is a scalp, eyebrow, or scarred region of the first subject. In another embodiment, the second scalp, eyebrow, or scarred region is a scalp, eyebrow, or scarred region of a second subject. Each possibility represents a separate embodiment of the present invention.
000123
In another embodiment, the excisional wounds of methods of the present invention are created using a surgical tool. In one embodiment, the surgical tool is a dermal biopsy punch (Example 2). In another embodiment, the excisional wounds are induced by freezing or cryoinjury. The use of freezing or cryoinjury is well known in the art, and is used, for example by dermatologists to injure skin. In one embodiment, the freezing or cryoinjury results in a blister. In another embodiment, the blister is used as a "chamber" to introduce drags and or cells into the reepithelialized area. Each possibility represents a separate embodiment of the present invention.
P-7628-PC
000124
In another embodiment, the excisional wounds of methods of the present invention are not surgically closed. In another embodiment, the excisional wounds are not contacted with a bandage or dressing before they heal or during a period of time after wound induction. In another embodiment, the excisional wounds are not contacted with an ointment before they heal or during a period of time after wound induction, hi another embodiment, the excisional wounds are allowed to heal by secondary intention. Each possibility represents a separate embodiment of the present invention.
000125
The subject of methods of the present invention, is, in another embodiment, a human. As provided herein (Example 7) human skin responds to EDIHN in the same manner as mouse skin. In another embodiment, the subject is a male. In another embodiment, the subject is a female. In another embodiment, the subject is any other type of subject known in the art. Each possibility represents a separate embodiment of the present invention.
000126
In another embodiment, the subject is an adult, hi one embodiment, "adult" refers to an age greater than about 18 years. In another embodiment, "adult" refers to an age greater than about 20 years, hi another embodiment, "adult" refers to an age greater than about 25 years. La another embodiment, "adult" refers to an age greater than about 30 years, hi another embodiment, "adult" refers to an age greater than about 35 years. In another embodiment, "adult" refers to an age greater than about 40 years. In another embodiment, "adult" refers to an age greater than about 45 years.
000127
In another embodiment, the subject is elderly. IQ one embodiment, "elderly" refers to an age greater than about 45 years. In another embodiment, "elderly" refers to an age greater than about 50 years, hi another embodiment, "elderly" refers to an age greater than about 55 years. Li another embodiment, "elderly" refers to an age greater than about 60 years. In another embodiment, "elderly" refers to an age greater than about 65 years. In another embodiment, "elderly" refers to an age greater than about 70 years.
000128
In another embodiment, the first subject, or, where applicable, both the first subject and the second subject, is a laboratory animal, hi another embodiment, the subject(s) is/are mice. In another embodiment, the subject(s) is/are rats. In another embodiment, the subject(s) is/are gerbils. hi
P-7628-PC another embodiment, the subject(s) is/are hamsters. In another embodiment, the subject(s) is/are guinea pigs, hi another embodiment, the subject(s) is/are rabbits. In another embodiment, the sύbject(s) is/are pigs. In another embodiment, the subjects) is/axe dogs. In another embodiment, the subject(s) is/are cats. In another embodiment, the subject(s) is/are primates. In another embodiment, the subject(s) is/are any other laboratory animal known in the art. Each possibility represents a separate embodiment of the present invention.
000129
In another embodiment, the subject(s) has a disease or disorder comprising balding. In another embodiment, the subject(s) does not have a disease or disorder comprising balding. In another embodiment, the disease or disorder is androgenetic alopecia (AGA). In another embodiment, the disease or disorder is male pattern baldness. In another embodiment, the disease or disorder is female pattern baldness. In another embodiment, the disease or disorder is a discoid lupus erythematosis. In another embodiment, the disease or disorder is a congenital hypotrichosis. In another embodiment, the disease or disorder is a lichen planopilaris. In another embodiment, the disease or disorder is a scarring alopecia. In another embodiment, the disease or disorder is any other disease or disorder comprising balding known in the art.
000130
In another embodiment, the scalp, eyebrow, or scarred region(s) has a majority of HF in the telogen stage of the hair cycle. The findings of Examples 5-6 show that (a) EDIHN can restore hair growth to the scalp, eyebrow, or scarred region at the telogen stage; and (b) the efficiency of EDIHN at the telogen stage can be enhanced by depilation prior to abrasion or wound induction. In another embodiment, the scalp, eyebrow, or scarred region(s) has more than about 60% of HF in the teiogen stage of the hair cycle. In another embodiment, the scalp, eyebrow, or scarred region(s) has more than about 70% of HF in the telogen stage of the hair cycle. In another embodiment, the scalp, eyebrow, or scarred region(s) has more than about 80% of HF in the telogen stage of the hair cycle, In another embodiment, the scalp, eyebrow, or scarred region(s) has more than about 90% of HF in the telogen stage of the hair cycle. In another embodiment, the scalp, eyebrow, or scarred regiøn(s) does not have a majority of HF in the lelogen stage of the hair cycle. Each possibility represents a separate embodiment of the present invention.
P-7628-PC
000131
In another embodiment of methods and compositions of the present invention;, the first step
(e.g. epithelial disruption) is performed 3-12 days prior to the second step (e.g. addition of an active compound, factor, cell, etc). In another embodiment, the interval is 4-12 days. In another embodiment, the interval is 5-12 days. In another embodiment, the interval is 4-11 days. In another embodiment, the interval is 6-11 days. In another embodiment,, the interval is 6-10 days. In another embodiment, the interval is 6-9 days. In another embodiment, the interval is 6-8 days. In another embodiment, the interval is 7-8 days. In another embodiment, the interval is 5-11 days. In another embodiment, the interval is 5- 10 days. In another embodiment, the interval is 7- 10 days. In another embodiment, the interval is about 1 week. Each possibility represents a separate embodiment of the present invention.
000132
In another embodiment, a method of the present invention further comprises the step of suppressing an activity or expression of a Wnt protein in the scalp, eyebrow, or scarred region. As provided herein, suppressing Wnt activity induces pigmentation in HF generated by methods of the present invention. In another embodiment, the step of suppressing Wnt activity or expression is performed within about 10 days of epidermal disruption. In another embodiment, the step of suppressing Wnt activity or expression is performed prior to the second step (e.g prior to addition of a compound or factor that promotes HF cell differentiation. Each possibility represents a separate embodiment of the present invention.
000133
hi another embodiment, the present invention provides a method for inducing pigmentation of a hair, comprising suppressing expression of a Wnt protein in a follicle of the hair. In another embodiment, the Wnt protein is Wntl. In another embodiment, the Wnt protein is a Wnt7. In another embodiment, the Wnt protein is a Wnt7a. In another embodiment, the Wnt protein is a
Wnt3. In another embodiment, the Wnt protein is a Wnt3a. In another embodiment, the Wnt protein is a Wntl 0. In another embodiment, the Wnt protein is a Wntl 0a. In another embodiment, the Wnt protein is any other Wnt protein known in the art. Each possibility represents a separate embodiment of ttie present invention.
000134
hi another embodiment, the present invention provides a method for inducing growth of a
P-7628-PC pigmented scalp hair or eyebrow of a subject, comprising generating a hair follicle in the scalp, eyebrow, or scarred region according to a method of the present invention and suppressing expression of a Wnt protein in the hair follicle, thereby inducing a growth of a pigmented scalp hair or eyebrow of a subject.
000135
In another embodiment, the step of suppressing expression of a Wnt protein comprises inducing an expression of a Dkkl protein. In another embodiment, the step of suppressing expression of a Wnt protein comprises inducing an expression of any other Wnt inhibitor known in the art. In another embodiment, the step of suppressing expression of a Wnt protein is performed immediately or shortly after epidermal disruption. In another embodiment, the step of inducing expression of a DMcI protein is performed immediately or shortly after epidermal disruption. In another embodiment, the step of suppressing expression of a Wnt protein is performed at the time of epidermal disruption. In another embodiment, the step of inducing expression of a Dkkl protein is performed at the time of epidermal disruption. In another embodiment, the step of suppressing expression of a Wnt protein is performed several days before generation of the follicle. In another embodiment, the step of inducing expression of a Dkkl protein several days before generation of the follicle. Each possibility represents a separate embodiment of the present invention.
000136
In another embodiment, the step of suppressing expression of a Wnt protein is performed for about 8 days. In another embodiment, the step of inducing expression of a Dkkl protein is performed for about 8 days. In another embodiment, the step of suppressing expression of a Wnt protein is performed for about 9 days. In another embodiment, the step of inducing expression of a Dkkl protein is performed for about 9 days. In another embodiment, the step of suppressing expression of a Wnt protein is performed for about 10 days. In another embodiment, the step of inducing expression of a Dkkl protein is performed for about 10 days. In another embodiment, the step of suppressing expression of a Wnt protein is performed for about 12 days. In another embodiment, the step of inducing expression of a Dkkl protein is performed for about 12 days. In another embodiment, the step of suppressing expression of a Wnt protein is performed during the period of re-epithelialization. In another embodiment, the step of inducing expression of a Dkkl protein is performed during the period of re-epithelialization. In another embodiment, expression of
P-7628-PC a DkId protein is halted after several days. In another embodiment, halting expression of DMd protein after several days induces, or enables induction of Wnt protein expression. Bi another embodiment, the expression of a Wnt protein is induced about 9 days after the abrating or wounding. In another embodiment, the expression of a Wnt protein is induced following the period of re-epithelialization. In another embodiment,, induction of Wnt protein expression is necessary for formation of new HF. Each possibility represents a separate embodiment of the present invention.
000137
In another embodiment, "several" refers to about 1 day. hi another embodiment, "several" refers to about 2 days. In another embodiment, "several" refers to about 3 days. In another embodiment, "several" refers to about 5 days. In another embodiment, "several" refers to about 7 days, hi another embodiment, "several" refers to about 10 days. In another embodiment, "several" refers to about 12 days. Each possibility represents a separate embodiment of the present invention.
000138
In another embodiment, the step of contacting in methods of the present invention comprises directly contacting the scalp, eyebrow, or scarred region with the compound, RNA, protein, etc. hi another embodiment, the step of contacting comprises indirectly contacting the scalp, eyebrow, or scarred region via contacting another site or tissue of the subject, after which the compound, RNA, or protein is transported to the scalp, eyebrow, or scarred region by a biological process; e.g, diffusion, active transport, or circulation in a fluid such as the blood, lymph, interstitial fluid, etc. Each possibility represents a separate embodiment of the present invention.
000139
In another embodiment, the epidermal disruption in methods of the present invention further removes dermal tissue from the scalp, eyebrow, or scarred region. In another embodiment, the epidermal disruption does not remove dermal tissue from the scalp, eyebrow, or scarred region. Each possibility represents a separate embodiment of the present invention.
000140
"Disrupting" an epidermis or epidermal layer refers, in another embodiment, to removing part of the epidermis or epidermal layer. In another embodiment, the term refers to disturbing the intactness of the epidermis or epidermal layer, hi another embodiment, the term refers to perforating the epidermis or epidermal layer. In another embodiment, only part of the the epidermal layer need be removed. In another embodiment, the entire epidermal layer is removed. In another embodiment,
P-7628-PC the term refers to abrading the epidermis or epidermal layer (Examples). In another embodiment, the term refers to wounding the epidermis or epidermal layer (Examples). Each possibility represents a separate embodiment of the present invention.
000141
In another embodiment, the epidermal disruption is performed with a tool that comprises sandpaper. In another embodiment, the epidermal disruption is performed with a laser. In another embodiment, the laser is a Fraxel laser. In another embodiment, the laser is a CO2 laser. In another embodiment, the laser is an exeimer laser. In another embodiment, the laser is any other type of laser capable of inducing trans-epithelial injury. In another embodiment, the epidermal disruption is performed with a felt wheel. In another embodiment, the epidermal disruption is performed with a surgical tool. In another embodiment, the epidermal disruption is performed with any other tool known in the art that is capable of epidermal disruption. In another embodiment, the epidermal disruption comprises use of a micro-dermabrasion device. In another embodiment, the epidermal disruption comprises a burn treatment.
000142
In another embodiment, the epidermal disruption comprises a disruption of a follicle of said epidermis and a disruption of an interfollicular region of said epidermis. In another embodiment, the epidermal disruption comprises a disruption of a follicle of said epidermis and does not comprise a disruption of an interfollicular region of said epidermis. Each possibility represents a separate embodiment of the present invention.
000143
In another embodiment, the epidermal disruption comprises a light-based method. In another embodiment, the epidermal disruption comprises irradiation with visible light. In another embodiment, the epidermal disruption comprises irradiation with infrared light. In another embodiment, the epidermal disruption comprises irradiation with ultraviolet radiation. In another embodiment, the epidermal disruption comprises orthovoltage irradiation. In another embodiment, the epidermal disruption comprises X-ray irradiation. In another embodiment, the epidermal disruption comprises any other type of irradiation known in the art.
000144
In another embodiment, the epidermal disruption is performed by mechanical means, hi another embodiment, "mechanical means" refers to abrading. In another embodiment, the term
P-7628-PC refers to wounding. In another embodiment, the term refers to ultrasound. In another embodiment, the term refers to radio-frequency. In another embodiment, the term refers to ab electrical process or the use of an electrical current. In another embodiment, the term refers to electoporation. In another embodiment, the term refers to exision. In another embodiment, the term refers to tape-stripping. In another embodiment, the term refers to microdermabrasion. In another embodiment, the term refers to the use of peels. In another embodiment, the term refers to any other type of mechanical means known in the art. Each possibility represents a separate embodiment of the present invention.
000145
In another embodiment, the epidermal disruption comprises chemical treatment. In another embodiment, the chemical is phenol. In another embodiment, the chemical is trichloracetic acid. In another embodiment, the chemical is ascorbic acid. In another embodiment, the chemical is any other chemical capable of epidermal disruption that is known in the art.
000146
Each method or type of method of epidermal disruption represents a separate embodiment of the present invention.
000147
In another embodiment, epidermal trauma is utilized in a method of the present invention.
000148
Each type of epidermal abrasion and epidermal trauma represents a separate embodiment of the present invention.
000149
In another embodiment, the epidermal disruption of methods of the present invention creates an abrasion at least about 1-1.5 centimeters (cm) in width. In another embodiment, the abrasion is at least about 1 cm in width. In another embodiment, the abrasion is at least about 1,5 cm in width. In another embodiment, the abrasion is at least about 2 cm in width. Each type of abrasion represents a separate embodiment of the present invention.
000150
In another embodiment, the scalp, eyebrow, or scarred region is not contacted with a bandage or dressing following the epidermal disruption. In another embodiment, the scalp, eyebrow, or scarred region is not contacted with an ointment following the epidermal disruption. In another embodiment, the scalp, eyebrow, or scarred region is allowed to heal for a period of time without being contacted by any substance, device, ointment, etc., that is ordinarily administered to an
P-7628-PC abrasion or wound to facilitate healing. Ih another embodiment, the scalp, eyebrow, or scarred region is allowed to heal for a period of time without being contacted by any substance, device, ointment, etc., that is ordinarily administered to an abrasion or wound to prevent infection. In another embodiment, the period of time is the time it takes the epidermal disruption to heal. In another embodiment, the period of time is any time or range of times between 2 days and 3 weeks. Each possibility represents a separate embodiment of the present invention.
000151
In one embodiment, "following" refers to a period of time of about 2 days. In another embodiment, "following" refers to a period of time of about 3 days. In another embodiment, "following" refers to a period of time of about 4 days. In another embodiment, "following" refers to a period of time of about 5 days. In another embodiment, "following" refers to a period of time of about 7 days. In another embodiment, "following" refers to a period of time of about 10 days. In another embodiment, "following" refers to a period of time of about 2 weeks. In another embodiment, "following" refers to a period of time of about 3 weeks. Each possibility represents a separate embodiment of the present invention.
000152
In another embodiment, a method of the present invention further comprises the step of depilating the scalp, eyebrow, or scarred region.. As provided herein, the findings of Example 6 show that the efficiency of EDIHN can be enhanced by depilation prior to abrasion or wound induction.
000153
In another embodiment, the depilation is epilation. In another embodiment, the depilation comprises the step of waxing. In another embodiment, the depilation comprises the step of plucking. hi another embodiment, the depilation comprises the use of an abrasive material. In another embodiment, the depilation comprises the use of a laser. In another embodiment, the depilation comprises the use of electrolysis. In another embodiment, the depilation comprises the use of a mechanical device. In another embodiment, the depilation comprises the use of thioglycolic acid. In another embodiment, the depilation comprises the use of any other method of depilation or epilation known in the art. Each possibility represents a separate embodiment of the present invention.
000154
In another embodiment, a method of the present invention further comprises the step of
P-7628-PC administering a topical retinoid to the scalp, eyebrow, or scarred region. In one embodiment, the topical retinoid induces resting (telogen) HF in the scalp, eyebrow, or scarred region to enter anagen. Each possibility represents a separate embodiment of the present invention.
000155
In another embodiment, the additional step (depilation or administration of a retinoid) is performed prior to the step of disrupting the epidermis. In another embodiment, the additional step is performed following the step of disrupting the epidermis, but prior to the addition of the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell. Ih another embodiment, the additional step is performed concurrently with the addition of the differentiation- promoting compound or factor. In another embodiment, the additional step is performed following the addition of the differentiation-promoting compound or factor. Each possibility represents a separate embodiment of the present invention.
000156
In another embodiment, the additional step is performed between about two days and about three weeks before the step of abrading. In another embodiment, the additional step is performed about two days before the step of abrading. In another embodiment, the additional step is performed about three days before the step of abrading. In another embodiment, the additional step is performed about four days before the step of abrading. In another embodiment, the additional step is performed about one week before the step of abrading. In another embodiment, the additional step is performed about ten days before the step of abrading. In another embodiment, the additional step is performed about two weeks before the step of abrading. In another embodiment, the additional step is performed about three weeks before the step of abrading. Each possibility represents a separate embodiment of the present invention.
000157
In another embodiment, the methods of the present invention further comprise the step of contacting the scalp, eyebrow, or scarred region with an inductive cell capable of inducing an epidermal cell to differentiate into an HF cell. In another embodiment, the HF cell is an HF stem cell. Each possibility represents a separate embodiment of the present invention.
000158
In another embodiment, the inductive cell is a dermal papilla cell. In another embodiment, the inductive cell is a follicular papilla cell, hi another embodiment, the inductive cell is a dermal
P-762S-PC sheath cell. In another embodiment, the inductive cell is a cell that has been genetically modified; for example, with a gene encoding a factor that activates one of the proteins or pathways shown in the present invention to be up-regulated in HF stem cells. In one embodiment, the factor is hedgehog. In another embodiment, the factor is a DP cell protein. In another embodiment, the factor is wingless/ int (wnt). In another embodiment, the factor is a Noggin protein, m another embodiment, the factor is a bone morphogenic protein (BMP). In another embodiment, the factor is a fibroblast growth factor (FGF). In another embodiment, the factor is a transforming growth factor beta (TGF-beta) protein. In another embodiment, the factor is sonic hedgehog protein. In another
• embodiment, the factor is a neurotropin. In another embodiment, the factor is any other factor known in the art that can contribute to induction of an epidermal cell to differentiate into an HF cell.
Each possibility represents a separate embodiment of the present invention.
000159
In another embodiment, the inductive cell has been genetically modified with a gene encoding a factor that represses one of the proteins or pathways shown in the present invention to be down-regulated in HF stem cells. In another embodiment, the inductive cell has been genetically modified with a gene encoding a factor that activates one of the proteins or pathways shown in the present invention to be up-regulated in HF stem cells upon their activation.
000160
In another embodiment, the inductive cell is an autologous cell. In another embodiment, the inductive cell is an allogenic cell.
000161
In another embodiment, the inductive cell is derived from a mesenchymal stem cell. In another embodiment, the inductive cell is derived from a mesodermal progenitor cell, hi another embodiment, the inductive cell is derived from a hematopoietic stem cell. In another embodiment, the inductive cell is derived from an embryonic stem cell. Ih another embodiment, the inductive cell is derived from an embryonic carcinoma cell. In another embodiment, the inductive cell is one of the cell types disclosed in United States Patent Application No.2003/0201815. hi another embodiment, the inductive cell is any other type of cell known in the art with inductive properties for an epidermal cell. Each type of inductive cell represents a separate embodiment of the present invention.
P-7628-PC
000162
In another embodiment, the epidermal cell (e.g. the epidermal cell that is induced to differentiate into an HF cell) is an epidermal stem cell. In another embodiment, the epidermal cell is a bulge cell. In another embodiment, the epidermal cell is any other type of cell known in the art that can be induced to differentiate into an HF stem cell. Each possibility represents a separate embodiment of the present invention.
000163
In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an anti-androgen compound. In one embodiment, the anti-androgen compound is finasteride. In another embodiment, the anti-androgen compound is Fluridil®. In another embodiment, the anti-androgen compound is dutasteride. In another embodiment, the anti-androgen compound is spironolactone. In another embodiment, the anti-androgen compound is cyproterone acetate. In another embodiment, the anti-androgen compound is bicalutamide. In another embodiment, the anti-androgen compound is flutamide. In another embodiment, the anti-androgen compound is nilutamide. In another embodiment, the anti- androgen compound is an inhibitor of an androgen receptor. In another embodiment, the anti- androgen compound is any oraer anti-androgen compound known in the art. Each possibility represents a separate embodiment of the present invention.
000164
In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an estrogen compound. Li another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an estrogen receptor agonist. In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an estrogen analogue. In one embodiment, the estrogen analogue is estradiol. In another embodiment, the estrogen analogue is 17 beta-estradiol. In another embodiment, the estrogen analogue is 17 alpha-estradiol. In another embodiment, the estrogen analogue is ZYC3. In another embodiment, the estrogen compound, estrogen receptor agonist, or estrogen analogue is any other estrogen compound, estrogen receptor agonist, or estrogen analogue known in the art. Each possibility represents a separate embodiment of the present invention.
P-7628-PC
000165
In another embodiment, a method of the present invention further comprises the step of contacting the scalp,, eyebrow, or scarred region with an inhibitor of an EGF protein. In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an inhibitor of an EGFR. In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with a compound that reduces an expression of an EGF protein or an EGFR. Each possibility represents a separate embodiment of the present invention.
000166
In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with a Hedgehog protein. In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with a nucleotide encoding a Hedgehog protein. In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with an activator of a Hedgehog protein. Each possibility represents a separate embodiment of the present invention.
000167
In one embodiment, a scalp is treated by a method of the present invention. In another embodiment, an eyebrow is treated. In another embodiment, any other hair-bearing area or region of the skin is treated. Each possibility represents a separate embodiment of the present invention.
000168
In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with a lithium compound. In one embodiment, the lithium compound contains a lithium ion. In another embodiment, the lithium compound contains a lithium atom.
000169
In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with (2'Z,3'E)-6- bromoindirubin-3'-oxime (BIO). In another embodiment, a method of the present invention further comprises the step of contacting the scalp, eyebrow, or scarred region with any other compound known in the art that is capable of inducing an epidermal cell to differentiate into an HF stem cell. Each compound represents a separate embodiment of the present invention.
P-7628-PC
000170
In one embodiment, the compound administered as part of methods of the present invention is administered systemically. In another embodiment, the compound is administered topically. In another embodiment, the compound is administered to the site of the abrasion. In another embodiment,, the compound is administered to the site of the wound induction. In another embodiment, the compound is administered to the site of the depilation. In another embodiment, the compound is administered during wound healing. In another embodiment, the compound is administered prior to HF neo-genesis. In another embodiment, the compound is administered during HF neo-genesis. Each possibility represents a separate embodiment of the present invention.
000171
In another embodiment, the present invention provides a method of inducing formation of an HF stem cell, comprising performing a method of the present invention. In another embodiment, the present invention provides a method of inducing formation of a DP cell, comprising performing a method of the present invention. Each possibility represents a separate embodiment of the present invention.
000172
In another embodiment, homologues and variants of transcripts and proteins of the present invention are administered in methods of the present invention. In another embodiment, homologues and variants of transcripts and proteins of the present invention are targeted in methods of the present invention. Each possibility represents a separate embodiment of the present invention.
000173
The terms "homology," "homologous," etc, when in reference to any protein or peptide, refer in one embodiment, to a percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Methods and computer programs for the alignment are well known in the art.
000174
In another embodiment, the term "homology," when in reference to any nucleic acid sequence similarly indicates a percentage of nucleotides in a candidate sequence that are identical with the nucleotides of a corresponding native nucleic acid sequence.
P-7628-PC
000175
In another embodiment, "homology" refers to identity of greater than 70%. In another embodiment, "homology" refers to identity of greater than 75%. In another embodiment, "homology" refers to identity of greater than 80%. In another embodiment, "homology" refers to identity of greater than 82%. In another embodiment, "homology" refers to identity of greater than 85%. In another embodiment, "homology" refers to identity of greater than 87%. In another embodiment, "homology" refers to identity of greater than 90%. hi another embodiment, "homology" refers to identity of greater than 92%. In another embodiment, "homology" refers to identity of greater than 95%. In another embodiment, "homology" refers to identity of greater than 97%. In another embodiment, "homology" refers to identity of greater than 98%. hi another embodiment, "homology" refers to identity of greater than 99%. In another embodiment, "homology" refers to identity of 100%.
000176
Protein and/or peptide homology for any amino acid sequence listed herein is determined, in one embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
000177
hi another embodiment, the present invention provides a kit, comprising a tools and/or a compound suitable for performing a method of the present invention.
000178
In another embodiment, the present invention provides a device, comprising a tool suitable for epidermal disruption and a means of delivering a compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell.
000179
hi other embodiments, the present invention provides a method of treating any disease, disorder, or symptom associated with balding. In other embodiments, the present invention, provides a method of treating any disease, disorder, or symptom associated with balding, hi other embodiments, the present invention provides a method of treating any disease, disorder, or symptom
P-7628-PC associated with balding. Each disease, disorder, or symptom represents a separate embodiment of the present invention.
Pharmaceutical Compositions
000180
In another embodiment, methods of the present invention comprise administering a pharmaceutical composition comprising the HF stem cell-inducing or -activating compound and/or its analog, derivative, isomer, metabolites pharmaceutically acceptable salt, pharmaceutical product, hydrate, N-oxide, or any combination thereof; and a pharmaceutically acceptable carrier. Each possibility represents a separate embodiment of the present invention.
000181
The pharmaceutical compositions containing the HF stem cell-inducing or -activating compound can, in another embodiment, be administered to a subject by any method known to a person skilled in the art, such as topically, parenterally, paracancerally, transmucosally, transdermally. intramuscularly, intravenously, intradermally, subcutaneously, intraperitonealy, intraventricularly, intracranially, intravaginally or intratumorally. Each possibility represents a separate embodiment of the present invention.
000182
In another embodiment, the pharmaceutical compositions are administered orally, and are thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation. Suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like. Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like. In one embodiment of the present invention;, the HF stem cell-inducing or -activating compounds are formulated in a capsule, hi another embodiment, the compositions of the present invention comprise, in addition to the HF stem cell-inducing or -activating compound active compound and the inert carrier or diluent, a hard gelating capsule.
000183
Ih another embodiment, the pharmaceutical compositions are administered topically to body surfaces and are thus formulated in a form suitable for topical administration. Suitable topical formulations include gels, ointments, creams, lotions, drops and the like. For topical administration, the HF stem cell-inducing or -activating compound or its physiologically tolerated derivatives such
P-7628-PC as salts, esters, N-oxides, and the like are prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
000184
hi another embodiment, the pharmaceutical compositions are administered by subcutaneous implantation of a pellet. In another embodiment, the pellet provides for controlled release of HF stem cell-inducing or -activating compound agent over a period of time.
000185
For liquid formulations, pharmaceutically acceptable carriers are, in another embodiment, aqueous or non-aqueous solutions, suspensions, emulsions or oils. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate. Aqueous carriers include, in another embodiment, water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Examples of oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
000186
hi one embodiment, the pharmaceutical compositions are controϊled-release compositions, i.e. compositions in which the HF stem cell-inducing or -activating compound is released over a period of time after administration. Controlled- or sustained-release compositions include, in another embodiment, formulation in lipophilic depots (e.g. fatty acids, waxes, oils). In another embodiment, the composition is an immediate-release composition, i.e. a composition in which all the HF stem cell-inducing or -activating compound is released immediately after administration.
EXPERIMENTAL DETAILS SECTION
EXAMPLE 1: DEPILATION AND EPIDERMAL ABRASION CAUSES DE NOVO HAIR FOLLICLE FORMATION MATERIALS AND EXPERIMENTAL METHODS
Depilation and epidermal abrasion
P-7628-PC
000187
Mice were anesthetized with an injection of sodium pentobarbital before the hair on the back was clipped and depilated withNair (Carter-Wallace, New York, NY), then epidermis was removed using a rotating felt wheel as described by Argyris T, J Invest Dermatol, 75: 360-362, 1980). After scrubbing with 70% ethanol and drying under an incandescent lamp, the basal and supra-basal layers in an area of (1.5 cm)2 cm of the inter-folHcular epidermis were removed by careful abrasion with a felt wheel mounted on a Dremel Moto-tool (Racine, WI). After abrasion, the skin was shiny and smooth, and there was no blood. One day later, the abraded area was covered by a fibrin crust, which fell off after 3-7 days, exposing the newly regenerated epidermis. A group of control mice was sacrificed immediately after abrasion to confirm microscopically the complete removal of the interfollicular epidermis.
Immunohistochemistry
000188
Skin samples were fixed in PBS-buffered 10% formalin. Six-micron thick paraffin sections were cut and stained, where applicable, with antibodies.
BrdU labeling
000189
The protocol described by Bickenbach and colleagues (Bickenbach et al, Cell Tiss Kinet 19: 325-333, 1986; Bickenbach et al, Exp Cell Res 244. 184-195, 1998) was used. Mice were injected with 50 milligrams per kilogram (mg/kg) bodyweight 5-bromo-2'-deoxyuridine (BrdU) every 12 hours for a total of four injections.
RESULTS
000190
An area of the backs of 50-day old mice was subjected to depilation and removal of the epidermis using a rotating felt wheel. Fifteen days later, HF placodes, hair germs and other signs of follicle neogenesis were present (Figure 1 ; arrow indicates a hair germ). Morphology of the follicles was similar to embryonic follicle development. To further characterize proliferation in the new follicles, the skin was labeled with BrdU 60 minutes before sacrifice. As depicted in Figure 2, the proliferation pattern was similar to developing follicles in the embryo.
000191
These findings demonstrate that (a) disruption of the epidermis causes generation of new
P-7628-PC
HF, and that this generation of new HF can occur (b) in adult subjects and (c) during telogen (50- day-old mice are in the second telogen stage of the hair cycle).
EXAMPLE 2: INDUCTION OF A LARGE EXCISIONAL WOUND, BUT NOT A SMALL PUNCH WOUND, CAUSES DE NOVO HAIR FOLLICLE FORMATION MATERIALS AND EXPERIMENTAL METHODS
Punch wound and excisional wound induction
000192
The backs of 21 -day-old mice were depilated as described for Example 1 and sterilized with alcohol, followed by 1% iodine solution. Punch wounds, 4 mm in diameter, were induced using a dermal biopsy punch, down to, but not through, the muscle fascia. Excisional wounds were full thickness and 1 cm in diameter; skin and panniculus carnosus was excised using fine surgical scissors.
RESULTS
000193
To test whether wounding could induce HF formation, punch wounds or excisional wounds were induced in mice. Both types of wounds exhibited contraction and re-epithelialization following wound induction; however, unlike the mice receiving punch wounds, the mice receiving excisional wounds also exhibited scar formation within 10 days of wound induction (Figure 3, left panel). No follicles were evident at this time point (Figure 3, right panel). 12 days after wound induction, hair germs, with similar morphology to fetal hair germs, were observed in the wound site, following BrdU pulse labeling (Figure 4). Several markers were used to verify that the observed structures were HF. The structures exhibited staining with anti-keratin 17 (K 17), an HF marker (Figure 5), and staining with anti-alkaline phosphatase at the 12 day time point verified that the structures had dermal papilli containing fibroblasts, as expected for HF (Figure 6; HF at earlier and later stages are depicted in the left and right panels, respectively).
000194
The HF generated by wound induction were further characterized by morphological
P-7628-PC comparison to embryonic HF9 following BrdU staining; a clear correspondence in morphology was observed at various stages (Figure 7). In addition., several markers of embryonic HF development, namely Left, wingless/ int (Wnt) 10b, and sonic hedgehog (Shh), were also induced in the epidermal disruption-induced HF neogenesis (EDIHN) (Figure 8). Additional BrdU staining (Figure 9) and staining for HF markers S 100A3 and S 100A6 (Figure 10; left panel: tissue section parallel to HF axis; right panel: cross-sectional view of follicle) provided further verification that the development of the EDIHN follicles closely paralleled embryonic HF development.
000195
These findings provide further evidence that disruption of the epidermis causes generation of new HF, and that this generation of new HF can occur (b) in adult subjects and (c) during telogen (21 -day-old mice are in the first telogen stage of the hair cycle).
EXAMPLE 3: EDIHN-INDUCED HAIR FOLLICLES GENERATE HAIRS
000196
At 25 and 45 days after wound induction, wound sites contained new hairs (Figure 11 „ left and right panels, respectively). New hairs appeared to lack pigmentation, except when the wnt pathway was inhibited, using Dkk-1 (Dickkopf-1) during the first nine days after wounding (see Example 10).
000197
These findings indicate that EDIHN-induced HF function normally; Le. are capable of generating hairs.
EXAMPLE 4: EDIHN HAIR FOLLICLES RETAIN THE ABILITY TO ENTER INTO CYCLICAL HAHl GROWTH
MATERIALS AND EXPERIMENTAL METHODS
BrdU labeling
000198
50 mg/kg bodyweight BrdU (Sigma) was injected twice per day for 3 days beginning 20
P-7628-PC days after wounding. BrdU was detected 40 days after wounding (17 day chase).
Whole mounting and immunofluorescence
000199
HF whole mounts were obtained by incubating fresh skin with EDTA (2OmM in PBS) at 37
0C overnight, then separating the epidermis and dermis. Epidermis was then fixed in 10% formalin for 10 min, room temperature (RT). Dermis was fixed in acetone overnight, RT. After rinsing with
PBS, whole mounts were stained with antibodies for immunohistochemistry (schematically depicted in Figure 12) and were imaged using a Leica confocal microscope.
RESULTS
000200
To determine whether EDIHN-induced HF contain normal levels of HF stem cells, mouse skin was examined for the presence of label-retaining cells at 21 days after wound induction.
Retention of BrdU during a long chase period is, under these conditions, one of the hallmarks of HF stem cells. Normal numbers and placement of label-retaining cells (in the bulge of the HF) were observed (Figure 13). To verify that the label-retaining cells were HF stem cells, K15-eGFP mice were utilized. In these mice, eGFP (enhanced green fluorescent protein) is expressed from the Kl 5 promoter; thus, expression of eGFP identifies HF stem cells. As depicted in Figure 14A5 eGFP- expressing cells were observed in in tissue sections (right side) of newly formed hair follicles 35 days following wound induction. eGFP-expressing cells were also seen in the epidermis whole mounts (bottom, far left panel) indicating the conversion of epidermal cells into cells with hair follicle stem cell characteristics, ([bottom, second from left] panel is same as [bottom, far left] panel but viewed under white light) This finding shows that the observed label-retaining cells exhibited HF stem cell properties.
000201
To determine whether EDIHN-induced HF cycle normally, mounts were prepared from additional mice at 35, 38 and 45 days after wounding. As depicted in Figure 14B, the EDIHN- induced HF entered the resting phase, telogen, and then re-entered a new anagen stage.
000202
In summary, the findings of this Example show that EDIHN-induced HF contain HF stem cells, as do embryonically generated HF. The presence of the HF stem cells shows that EDIHN-
P-7628-PC induced HF retain the ability to enter into cyclical hair growth in the same manner as embryonically generated HF. The findings also show that wounding induces epidermal cells to assume a hair follicle stem cell state (expressing Kl 5-eGFP). This model is shown schematically in Figure 15. The findings of Examples 2, 3, and 4 showthat EDIHN-induced HF are fully functional and thus able to restore hair growth to a subject in need.
EXAMPLE 5: EPIHN-INDUCES NEW HAIR FOLLICLES IN MICE AT THE TELOGEN STAGE OF THE HAIR CYCLE
000203
To determine whether EDIHN was induced new hair follicles in mice wounded at the telogen stage of the hair cycle, 21 -day-old mice were subj ected to ED3ΗN using a 1 -cm excisional wound, as described in Example 2, Sldn was then examined by whole-mount assay for indications of new HF. As depicted in Figure 16, after 11 days, new HF were not evident by macroscopic examination (top panel), AP staining of the dermis (bottom left panel), or KI 7 staining of the epidermis (bottom right panel). After 14 days, as depicted in Figure 17, dermal papilla cells were detected in the dermis (left panel) and HF stem cells in the epidermis (right panel), demonstrating that new follicles were being formed. After 17 days, the new follicles were more developed, as shown by examination of the dermis and epidermis (Figure 18, left and right panels, respectively). This method induced formation of an average of 49 new follicles in the wound, a number that was consistent over three separate experiments, as depicted in Table 1.
000204
Table 1. Results of three separate experiments performed on 21 -day-old mice.
P-7628-PC
000205
The findings of this Example demonstrate that EDIHN is capable of inducing formation of new HF in mice at the telogen stage of the hair cycle, despite that fact that these mice do not contain HF at the anagen stage during wounding.
EXAMPLE 6: IN ADULT MICE. INDUCTION OF ANAGEN INCREASES THE EFFICIENCY OF EDIHN
000206
The experiment described in Example 5 was repeated with mice of different ages, and therefore at different stages of the hair cycle. To ensure that wound scarring occurred, larger wounds were in induced in the older mice. As depicted in Table 2, adult mice at telogen, such as 8-week-old mice, exhibited lower efficiencies of HF formation by EDIHN.
000207
Table 2. Efficiency of HF formation by EDIHN in adult mice at various stages of the hair cycle.
- The second telogen lasts approximately 40 days in mice. Thus, 14-week-old and 20- week-old mice contained a mixture of telogen and anagen HF.
000208
To determine whether experimental induction of anagen increased the efficiency of EDIHN,
P-7628-PC
8-week-old mice were depilated several days prior to wound induction. As depicted in Figure 19, the wounds closed similarly whether or not they were preceded by depilation. As depicted in Figure 20A-B, the depilated mice exhibited enhanced EDIHN relative to the non-depilated mice depicted in the previous Example by a factor of 11 -fold.
000209
The findings of this Example demonstrate that anagen induction enhances EDIHN. In addition, these findings show that EDIHN is capable of not only forming new HF, but also of activating anagen in pre-existing HF in the telogen stage.
EXAMPLE 7: EDIHN-INDUCES NEW HAIR FOLLICLES IN HUMAN SKIN MATERIALS AND EXPERIMENTAL METHODS
Grafting
000210
Discarded human, adult scalp from the preauricular area obtained from plastic surgery was grafted onto immunodeficient (scid) mice. The graft was bandaged and allowed to heal, then was used in the wound healing study 3 months after grafting.
RESULTS
000211
To determine whether human skin responded to EDIHN as did mouse skin, human skin was grafted onto SCID (immuno-deficient) mice and subjected to depilation by plucking and wound induction three days later. Seven days following wound induction, formation of new HF was observed in the human skin (Figure 2 IA; arrows indicate new HF) by hematoxylin and eosin staining of paraffin embedded tissue sections.
000212
In additional experiments, adult human skin was grafted onto mice., abraded, and examined at 7 days post-abrasion. New HF were generated in the human skkx, which mimicked normal hair follicle formation during fetal development, as evidenced by staining for SlOO A6 or S100A4 (Figure 21B).
P-7628-PC
000213
The results of this Example show that EDIHN can be used to generate hair growth inhuman skin as for mouse skin.
EXAMPLE 8: MOLECULAR PATHWAYS ACTIVATED DURING HF STEM CELL ACTIVATION MATERIALS AND EXPERIMENTAL METHODS =
Isolation and activation of HF stem cells
000214
Kl 5~eGFP mice were depliated in order to induce formation of new HF. Activated hair follicle stem cells were isolated from K15-eGFP mice using fluorescence-activated cell sorting (FACS) two days after depilation and 5 μg (micrograms) total RNA from the cell population was isolated, reverse-transcribed and hybridized to an Affymetπx (Santa Clara, California) array MG_U74v2 chip. Scanned chip images were analyzed using Affymetrix Microarray Suite 5.0 and GeneSpring software (Silicon Genetics) to detect fold-change differences between activated HF stem cells (HFSCs) and non-activated (telogen) HFSCs. Values were normalized before computing fold-changes and differences between non-activated "bs-line" and activated ("expt") samples.
RESULTS
000215
To identify molecular pathways up-regulated during HF stem cell activation, activated HF stem cells were isolated, and the gene expression patterns of the cells were analyzed to detect up- regulated transcripts. The transcripts depicted in Table 3 were up-regulated at least 2~fold in the activated HF stem cells relative to the cells prior to activation. In some cases, the sequence in Table 3 is a genomic sequence that contains the sequence of the transcript. Data pertaining to the up- regulation of the transcripts and further information about them is provided in Figure 22.
000216
Table 3. RNA transcripts up-regulated during HF stem cell activation.
(Section omitted, see original document)
P-7628-PC
000221
Thus, the transcripts identified in this Example, the proteins they encode, and the pathways in which the proteins participate, contribute significantly to induction of epidermal cells to differentiate into HF stem cells. Activation of the transcripts, proteins, and pathways depicted in Table 4 is thus a method for enhancing EDIHN. In addition, inhibition of the transcripts, proteins, and pathways depicted in Table 4 is thus a method for preventing EDIHN and eliminating hair follicles. In. addition, inliibition of the transcripts, proteins, and pathways depicted in Table 5 is a method for enhancing EDIHN. In addition, activation of the transcripts, proteins, and pathways depicted in Table 5 is thus a method for enhancing EDIHN.
EXAMPLE 10: EXPRESSION OF WNT-I INHIBITORS DURING THE FIRST NINE PAYS AFTER WOUNDING CAUSES PIGMENTATION OF NEW HF MATERIALS AND EXPERIMENTAL METHODS
000222
In this Example, doubly transgenic mice expressing both tetO-Dkkland K5-rtTA were utilized. When these mice are fed chow formulated with 1 g/kg doxycycline (BioServ, Laurel, MD), they express DkId , under the control of the K5 promoter, in the basaϊ epidermis. The control mice also received doxycycline, but they were K5-rtTA negative and thus did not express Dldd.
RESULTS
000223
A 1 cm2 wound was induced on the lower back of the doubly transgenic mice at 21 days or 50 days old. Mice were placed on doxycycϊme-containing chow immediately after wounding to induce Dldd expression, and then doxycycline was discontinued after completion of the re- epithelialization at 9 days after wounding. Dkkl expression inhibits Wnt activity, which in turn induces follicle pigmentation. At 22 days after wounding, pigmented HF were observed in the excised skin after preparing the epidermal sheet (Figure 23 A-B). Control mice lacked pigmented HF (Figure 24).
000224
In other experiments, continued expression of Dkkl after the 9-day period inhibited
06 011319
P-7628-PC formation of new HF.
000225
The findings of this Example show that pigmented HF can be produced by suppressing expression of Wntl or by inducing expression of Dkkl during the period of re-epithelialization, then inducing expression of Wntl . In addition, the findings of this Example show that factors that inhibit neonatal hair follicle formation (e.g. Dkkl ) also inhibit EDIHN, thus further supporting the notion mat hair follicles formed by EDIHN are similar to normal hair follicles.
EXAMPLE 11: INHIBITION OF EDIHN BY EPIDERMAL GROWTH FACTOR INJECTION
000226
21 day-old mice were wounded as described in previous Examples. Starting from day 11 after wounding, a time point corresponding to the point at which the wound had recently re- epithelialized, 10 μL of 1 μg/ml EGF was injected into the wound bed. EGF was injected once per day after this point for a total of 5 days. Three days later, the skin was collected, and whole-mount
EDIHN assays were performed. EGF prevented HF formation as assessed by gross morphology. In addition, whole mounts of control and treated skin were analyzed with anti-K17 antibody immimostaining. All mice injected with EGF (n=4) exhibited no new HF formation (Figures 25 A-
B), while control mice (n=2) had many new HF5 as expected. (Figures 25 C-D).
000227
In an additional experiment, recombinant EGF (1 microgram (mcg)/microliter (mcl)) was injected at days 11, 13 and 15 after wounding. Skin was collected at 18 days after wounding and stained for K,17 and alkaline phosphatase. Once again, administration of EGF inhibited EDIHN.
000228
The findings of this Example show that EGF inhibits HF formation. Thus, inhibiting EGF, EGFR, or one of the pathways in which they participate increases EDIHN-induced HF formation.
EXAMPLE 12: ENHANCEMENT OF EDIHN BY INHIBITION OF EGF RECEPTOR
000229
To determine the effect of administration of EGF receptor inhibitors on DIHN, the inhibitor
P-7628-PC
AG1478 (150 μM in 10 μL volume) was administered as a single injection. 11 days after incisional wounding (1 cm2) to the middle of the wound near the skin surface. EGF receptor inhibitor administration led to generation of more and larger hair follicles compared with control mice that were wounded only (Figure 26A). As shown in Figure 26B, large hair follicles developed in the wounded area in the AG1478-injected mice. Left panel: epidermis stained for Kl 7, with three large hair follicles next to each other. Right panel: dermis stained for AP with large coalescing dermal papilla areas.
000230
The findings of this Example confirm the results of the previous Example, and show that more and larger HF can be generated when EDIHN comprises, or is followed by, administration of EGFR inhibitors, or with compounds with a similar mechanism of action; e.g. Hedgehog protein and androgen antagonists.
EXAMPLE 13: ENHANCEMENT OF EPIHN BY EXPRESSION OF A β-CATENIN ACTIVATOR
000231
To determine the effect of administration of β-catenin activators on EDIHN, K14-Wnt7 transgenic mice, which overexpress the β-catenin pathway activator, Wnt7, in the epidermis, were subjected to EDIHN, then HF formation was measured 19 days after wounding. In each of 2 separate experiments, with 4 week old and 3 week old mice, the transgenic mice developed significantly larger numbers of HF compared to control, non-transgenic littermate mice (Figure 27 A-C).
000232
Thus, administration of β-catenin activators leads to an increase in EDIHN. The findings of Examples 11-13 show that new HF can be generated by (a) disrupting the epidermis; and (b) administering a factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell.
EXAMPLE 14: ENHANCEMENT OF EPIHN BY ADMINISTRATION OF FGF
P-7628-PC
000233
To determine the effect of fibroblast growth factor (FGF) on EDIHN, recombinant FGF is administered 11 days after incisional wounding, as decribed in Example 11. FGF administration enhances HF formation, showing that new HF can be generated by (a) disrupting the epidermis; and (b) administering FGF. a nucleotide encoding FGF, or a factor that increases signaling by FGF.
EXAMPLE 15: ENHANCEMENT OF EDIHN BY ADMINISTRATION OF EDAR
000234
To determine the effect of fibroblast growth factor (FGF) on EDIHN5 K14-Eda-Al transgenic mice, which overexpress (ectodysplasin-Al) Eda-Al in the epidermis, are subjected to EDIHN, then HF formation is measured 19 days after wounding as described in Example 13. The transgenic mice develope significantly larger numbers of HF compared to control, non-transgenic littermate mice, showing that new HF can be generated by (a) disrupting the epidermis; and (b) administering a factor that enhances signaling by ectodysplasin.
EXAMPLE 16: ENHANCEMENT OF EDIHN BY ADMINISTRATION OF MINOXIDIL
000235
To determine the effect of minoxidil on EDIHN, recombinant FGF is administered 11 days after incisional wounding, as decribed in Example 11. Minoxidil administration enhances HF formation, showing that new HF can be generated by (a) disrupting the epidermis; and (b) administering a minoxidil.
EXAMPLE 17: REMOVAL OF HF BY ABRASION AND ADMINISTRATION OF EGF
000236
Hair-bearing regions of the epidermis of mice is abraded, as decribed in Example 1, then administering recombinant EGF, as described in Example 1. This method prevents hair re-growth in the abraded areas, showing that hair can be removed by (a) disrupting the epidermal layer; and (b) administering EGF, a nucleotide encoding EGF, or a factor that increases signaling by EGF.